how actor soori was cheated by a top cop - savukku shankar interview
ฝัง
- เผยแพร่เมื่อ 26 ส.ค. 2024
- how actor soori was cheated by a top cop - savukku shankar interview
tamil news today
/ @redpixnews24x7
For More tamil news, tamil news today, latest tamil news, kollywood news, kollywood tamil news Please Subscribe to red pix 24x7 goo.gl/bzRyDm
red pix 24x7 is online tv news channel and a free online tv
இதுக்கு முன்னாடி சவுக்குக்கு ரசிகன் 😍 இந்த பேட்டிக்கு அப்புறம் நான் தீவிரமான ரசிகனாயிட்டேன் ❤ யப்பா என்ன ஒரு தெளிவான பேச்சு அதுவும் சலுப்பு தட்டாமல் சுவாரசியமாக நகைச்சுவையோடு பேச இவரால் மட்டுமே முடியும்😍🔥
ஆம் உண்மை தான்
பொய் எப்போதுமே இப்பிடி தான் இருக்கும்
Savuku the best
Same here I wants his TP number.
Yes he is so intelligent
சவுக்கு சங்கர் தமிழ்நாட்டின் பொக்கிஷம் உண்மையில் அருமையான மனிதர் அருமையான பதிவு வாழ்த்துக்கள் சார் உங்க பதிவு
Feeling sad for Mr Soori! This guy's Vishnu Vishal spilled venomous words on soori guarding his father. Such a gentleman soori is he never uttered a word ABT him!
Vishnu Vishal is a thug, Cheat and 420. No wonder he learned all these traits from his dad.
Pagutharivudan nadapadharku padiparivo patinathu vazhkaiyo thevai illai nalla valarpu irundhal podhum. Adhu nadigar Thiru soori avargalidathil parkirom adhanal dhan avar endha varthaiyum thevai illamal pesa villai... Matravagalai edhuvum solla thevai illai avargalin yogyedhai avargalukey theriyum.. adhaivida padaithavan parthukondu dhan irukiran..thapikave mudiyadhu...vidadhu karupu madhri ...Vidhi valiyadhu...sariyana nerathil vandhu sandhikum indha emathukarargalai... Nandri 🙏
He spoiled his wife's life, now innocent actor life
@@manjunath.mmanjunath1107he married Rajinikanth’s BFF Natraj ‘s daughter for film contacts . He is acting in Aishwarya directed Lal Salaam, yet his wife & son are not there to share his happiness , opportunist 😢
சூரி ஒரு எதார்த்தமான ஆளு பாவம் நம்பி கெட்டு விட்டார் அவருக்கு நடந்தது மிகப்பெரிய கொடுமை
சட்டம் அவருக்கு நல்லதொரு தீர்ப்பை தந்து உதவ வேண்டும் என நான் இறைவனை வேண்டுகிறேன்
சரியான நீதி இறைவன் கொடுக்க மாட்டார்
நிறைய பேர் இப்படி ஏமாற்றப்படுகிறார்கள் சூரி மட்டும் அல்ல..... இவர் ரொம்பபும் பேமசான ஆள்.. சங்கர் இப்படி ஏமாற்றப் படுப்பவர்களை எல்லாம் கண்டுபிடித்து பேச வேண்டும்... எல்லா போலீஸ் ஸ்டேஷன் போய் விசாரித்தால் தெரிந்துவிடும்... இல்லையா? இந்த உலகமே fraud ஆகாதான் இருக்கு...
innuma nethi nermai nu namburinga
Neethi…. K…. Kilikkum
தமிழில் ஒரு பழமொழி உண்டு "இன்றைய நண்பன் நாளைய விரோதி".
Hello Savukku Shankar sir
Thank you for bringing all these details to light
எங்கே சங்கர் sir போகாத பேசாத area va கிடையாது சூப்பர் sir 💐💐💐
Ama ama..
Avanuku epde da Ella teriyum,nalaiku unga appan yarunu Avan vandhu somadhan terinjpeenga pola
@@rajantamil2074 இப்படித்தான் சீமான் பேசினார். தம்பிகள் ஆர்ப்பரித்தனர். அவரை இயக்குபவர் யார்? நோக்கம் என்ன என்பது பின்னர் தெளிவாக புரிந்து விலகினர். ஆர்ப்பாட்டமாக பேசுபவர்களை துவக்கத்தில் பலர் கொண்டாடுவர். பின் சாயம் வெளுக்கும்.
Verithanamana interview annan savukku savukku tan👌💪
இந்தப் பேட்டியைப் பார்த்த பின்பு விஷ்ணுவிஷால் மீதுள்ள மதிப்பை போய்விட்டது குறிப்பாக அவர் நடித்த ஒரு பாடல் விட்டு விட்டு மின்னல் வெட்டும் இந்த பாடல் மிகவும் பிடிக்கும் இனிமேல் அந்தப் பாடலை பார்ப்பதற்கு மனது இல்லை
Yarennasonnalum.nampympadirgrhamanirharkalwrujkumvarai.enrhamathieixhenalvekanakavalarum.pilicetapoivisaranaijkuvarasonna.angepoisiruppukattinalpolice.ennaseivathu
@@kumarr2831 loosu payya
@@nettrikan6333 ஹாஹாஹாஹா
Irandu peraum vaithu pesinaale unmai therium yaara pattium mudivu seiya naam yaar
நமக்கு எதிரி வெளி எப்போதும் இருந்ததில்லை.. அருகில் தான் இருப்பார்கள்... நண்பன் உறவினர் யாரையும் முழுவதும் நம்ப வேண்டாம் இது கலி காலம்..
💯💯
Yes.....
ஏமாற்றியவர் தமிழன் இல்லை.. ஏமாற்றியவர் தெலுங்கன்...
😥
Aamanga koodave irukravanga thaan ipdi irukaanga
சூரி அண்ணனுக்கு நியாயம் கிடைக்க வேண்டும் 💯🙏🏻❤😍
ஒரு படம் பார்த்த Feelings இருக்கு சவுக்கு அண்ணா..,
S
அவன் வயிற்றெரிச்சல் உங்க ரெண்டு பேருக்கும் காமெடி,
Amam engaluku comedy than 😂
இவர் அரசியல் பேசும் பயில்வான்… வேறென்ன எதிர்பார்கிறீர்கள்???
சூரிக்கு ஆதரவாக உண்மையை பேசும் பேச்சை மட்டும் பாரும் அந்த தைரியம் தான் சவுக்கு
சவுக்கு " உங்களின் ஒவொரு பேட்டி யும் full blast என்டேர்டைனிங், ட்ராமா and gripping... வாழ்த்துக்கள் 👌👌👌👌💐
The main problem for Suri's is that he has not individually consulted any lawyer of repute in chennai. He has been such a guy believing everybody.
மற்றவரை ஏமாற்றிய பணம் நிலைக்காது (கர்மா)அவர்களின் குடும்பத்தை பாதிக்கும்
நேர்மையாக உழைத்து சம்பாதிக்க முடியாது ஏமாற்றியதால் சொகுசாக வாழ முடியும் புத்தி இருக்கிறவன் புரட்சிக்கும்
Apdi onnu therila
அதெல்லாம் நூத்துல ஒன்னு ரெண்டு
Unmai
This is why education is important guys
In today's world.. even educated people get cheated... the world is very cruel... money money money..in any way and in any form.
Also current affairs
Sir I have master degree i buy land in kanchipuram which sipcot occupied already noticed i ask registration office enquiry patta all verified by advocate even advocate also buy dtcp approved land cheating after i get noticed 5yr over even i didn't get my money from government
Even literate people get cheated more... Case is not about education it's about trust...
@@anukutti1156 Money is necessity, Free lunch will not be available more than 3 times even with friends, At one time they will try to avoid you, now your talking about trusts
எல்லா மனிதர்களும் எதோ ஒரு நம்பிக்கையில் தான் சிரித்துக் கொண்டிருக்கிறார்கள்.
நீங்க ரெண்டு பேரும் விவாதிக்கறீங்கன்னாலே, பின்னி பெடலை எடுப்பிங்க. சூப்பரோ சூப்பர்.
பிரபல நடிகருக்கே இந்த நிலைமை என்றால் நம் போன்ற சாதாரண மக்கள் நிலை ????
Tbh Soori was stupid to believe without due diligence. He should have felt something fishy when they said they got the land plans secretly. Big red flag. Common man sometimes is more intelligent than famous people
13:53 Savukku smile😂
This is one more example for a common man to not approach Police. Today, a police officer is protected and tomorrow someone who bribes the police gains support. Fed up with the system.
சவுக்கு sir இது போன்ற அப்பாவிகளுக்கு நீங்கள உதவலாமே.
*இதை பற்றி பேசுவதே பேருதவி தான்*
*அது அண்ணன் சவுக்குவுக்கு தெரியும்*
Dmk sombhu sollitaru
No one can help because it's a very big mafia with political power
சூரி அவர்கள் கேட்காமலே இவர் ஃபீல்ட் ஒர்க் பண்ணி இவ்வளவு செய்தியை சேகரித்து பேட்டி கொடுத்துள்ளார் இதுமட்டுமில்லாமல் சூரியிடம் பேசுவதற்கும் அவர் நேரம் கேட்டுள்ளார் சூரி தான் அவருக்கு நேரம் கொடுக்கவில்லை ஆகவே இவருடைய மனித நேயத்துடன் நடந்து கொண்டிருக்கிறார் ஆகவே சவுக் அண்ணன் அவர்கள் மிகவும் பாராட்டுக்குரியவர்
எல்லா நிகழ்வுகளையும் எடுத்து பேசிக்கொண்டிருக்கும் சவுக்கு சங்கர் எனது நன்றிகளும் பாராட்டுக்களும் வாழ்க குடும்பத்துடன் என்றும் எனது மதுர வீரன் அய்யனாரப்பன் உங்களுக்கு துணையாக இருப்பார்கள் நன்றி வணக்கம் வாழ்க தமிழ்
It's a weekend... Like many, have OTT subscriptions but ended up watching Mr. Shankar's interviews... Time spent is equal to watching a 2 and 1/2 hour movie!!! No, explanation.... Just hooked at this words!!!
exactly
💯
Its an eye opening Interview Mr Felix and Shankar🙏👏, I never trusted Vishnu Vishal and his dad from the beginning of this case.. Its a sad state of affairs people getting cheated like Soori.. Poor guy, Hope justice prevails and the culprit gets his dues…
visnu get more lessions from his new wife i donot know how long this last
விஷ்ணு விஷால் பேசறது எல்லாம் நடிப்பா கோபால் 😭😭😭
தெலுங்கன் அப்படி தான்.. சிலர் விதி விலக்கு
Ama
Vishnu vishal , vishal , arya , udai stalin ivunga ellarum sema close ana frnds. Intha motha gang eh no 1 fraud and cheap persons.
ஏமாற்றியவன் எவன் உண்மை பேசி உள்ளான் சகொதரங்களெ?அடி தடி உதவுமாப்போல் அண்ணன் தம்பி உதவான் என்று தமிழர்கள் பேசுவர்.தமிழ் நாட்டை பிற மானிலத்தார் கையகப்படுத்தி சின்னா பின்னமாக்கி விட்டார்கள் பூர்வகுடி தமிழனையும் பழக்கப்படுத்தி விட்டார்கள்,
Avar thaa sirantha nadigar aache
So sad for Soori. He shd have asked a few close friends. Even Sivakartigen would have told him don't do it. He is smart.
Soori was more close to Vishnu Vishal than Sivakarthikeyan....
A bank manager cheated my mum in the same way. Good to see you raise these issues.
What happened??
Long story. but oh. Happy ending.
@@rtk3162 thanks for query. Perhaps I should record that experience into the Commons too.
this is exactly what I had guessed after Soori first interview. I guessed exactly the same scenario when vishnu vishal had spoken out. Nowadays cheaters are there everywhere and more in chennai mainly with real estate domain. if I could guess all happenings with my 5-6 months exposure in such cases ,definitely any investigating police officer could understand within minutes as they come across such cheating cases almost every day.
Normally a corrupted AC can earn 5-6 lakhs bribe \month at avg in a city like chennai. Imagine what a corrupted ADGP could earn and the muscle power they possess with the system. They know the law points - loopholes in & out too. I have some exposure with police behavior in such cases as I had given complaint last year with a cheater for 15 lakhs. I was asked to come multiple times atleast 10 times to salem & coimbatore but the cheater came only once as he was well supported by police there. Soori could have gone directly to high court with proofs to file FIR on the ADGP as that's the only hope for him. At the same time I came across honest IPS officers in madurai who are straight forward solved our other case within a day when a real estate broker tried to cheat my parents with a chennai - vandalur plot as our madurai DC -AC helped us to sort it in a single day and they are real pride policemen but unfortunately they are less than 10%. people need to be really careful with buying properties & with such cheaters because our law system is such that with so many loopholes & dishonest officers supporting cheaters everywhere.
Hi bro how to check we are getting correct property without any issues
@@katana_3558 hire good lawyers - perform 2 different lawyer verification to check EC, mother documents ,Patta and legal heir documents if its undivided property. Apply for bank loan approval even if you intent to buy with full cash, even if its approved layout to check if eligible for loan . Registrar office you can get some clerical level person to validate everything if you pay 5-6k with real site visit as they know local area much better. If you buy through brokers always contact buyers directly and check all needed info about path to land , legal heirs, price etc . Don't trust brokers whatever the commitment they give.For safety purpose record all voice calls to buyers - brokers. As mostly in document you would specify 30 lakhs market value and actually you pay 70-80 lakhs for a property current value. Try to make payment in DD or online transfer avoid cash payment unless you deal with black money.These are some basics. if you make cash payment do it in SR office and complete registration immediately.
@@ramkarthik100 bro why do u say always apply for loan even if u have ful cash..is it like the bank will do through investigation if the property has issue or not before giving loan? Plus nobody takes money online bro ..if u have white money
Wait we se c u in prison soon
@@katana_3558 yes bank will have reputed highly paid lawyers to do through investigation
நல்ல மனிதர் சூரி
மிகவும் அருமை
Vishnu vishal has spoken against soori in so much videos but there was doubt like why soori didn't speak... then here comes the truth... By savukku sankar
Thanks for explaining all things even though you guys know all those intricate details. These things educate us too. 7-8 yrs back I was also about to be cheated something like this with a plot in vandalur-kelambakkam road. Just by inquiry, and on the day of site visit itself I understood that there is no road from the main road to the site. Somehow politely I rejected that offer. I was in my mid 20s then. Now, because of this video, I can share to many of my well wishers not to get fooled by certain people.
AAN and ndaattu makkallukku chaevai chennai ullitta palar kurram chaatti varukirrathu enpathu allavil kurrippitaththakka thangkall kattuppaattil irundtha kattuppaattil ulla anaiththu ulla anaiththu irundtha ndilaiyil vazhakkilindtha itangkallilum indtha
சவுக்கு ஷங்கர் மற்றும் ஃபெலிக்ஸ் மிக தெளிவான உரையாடல் . இவ்வாறு ஒரு சம்பவத்தை கதையாக கூறும்போது அதை கேட்க ஆர்வமாக இருக்கும் .
உண்மை தான்
❤ you savukku bro.. Binge watching.. Netflix must give you two a program..
Po da kirukku koo
Disgusting cheating..... So sad about the comedian.... Plz do some thing and support to get justice...
வல்லவனுக்கு வல்லவன் வையகத்தில் உண்டு
மிகப் பெரிய பாவம் நம்பிக்கைத் துரோகம்.
Sir... U both are my favourite combo.... Pls talk more than 2hrs.. 🙂
நல்லா சுவாரஸ்யமாக கதை செல்லுவது போல் சொல்லுராய்ங்க நல்லா தான் இருக்கு
Yes
இவர் அரசியல் பேசும் பயில்வான்…
You have fettish
I feel it’s an awareness interview for common people, tks for the team for arranging these. Soori trusted people but he got cheated by the same people
3:21 video starts
👏
🙏🙏
Thanks
Nanrigal
Super
தோழரே நிகழ்ச்சி மிக மிக அருமை அதுவும் குறிப்பாக அந்த நிலமோசடி தற்போது ரொம்பவே நடக்கிறது அதைப் பற்றி நீங்கள் விரிவாக பதை இல்லாததற்கு என்ன. பாடுபடுவார்கள் என்று குறிப்பிட்டு சொன்னீர்கள் மிக மிக அருமை சூப்பர்
Very good speach sir. உங்கள் நேர் Ganale வேற லெவல். பாராட்டுகள் savuku shankar sir. Ungalai போன்ற நேர்மையான udagaviyalar நம் நாட்டுக்கு Migavum Thevai.
Feeling sad for innocent people.. govt officials must be genuine in their duty...
We are in india.. don't expect that
Govt and Govt officials are the biggest nightmare for ppl
சவுக்கு சங்கருக்கு மறுபெயர் துணிச்சல் 👍
Mr.Felix! you have interuppted Mr. Shankar many times in this video when he came to say something. Please allow Mr.Shankar to complete his sentence always.
Yes u r absolutely correct
Yes
yes..lot of interuptions..a good journalist/anchor should be a good listener too
காவல்துறை மீதான புகார்களை விசாரிக்க தனி ஆணையம் ஏற்படுத்தவேண்டும்..அப்போதுதான் இது போன்ற பிரச்சனைகளுக்கு தீர்வு கிடைக்கும்
Unmai
@@user-tamil5671 அந்த ஆணையம் என்பது தனி மனித ஆர்வலர், முன்னால் நேர்மையான போலிஸ் அதிகாரி, முன்னாள் ராணுவ அதிகாரி, ஒரு ஜட்ஜ், மனித உரிமை ஆர்வலர், ஒரு வக்கீல் அடங்கிய குழுவாக இயங்க வேண்டும்...இது ஒவ்வொரு மாவட்டத்திலும் இருக்க வேண்டும். அரசு, காவல்துறை, குற்றவாளிகள் ஒருவரே....சட்டைதான் வேறு... விதிவிலக்குள் உண்டு....முதலில் காவல்துறையை அரசாங்கத்தின் லிடியில் இருந்து முற்றிலும் நீக்கி தன்னிச்சையாக செயல்படும் ஒரு துறையாக மாற்றினால் மட்டுமே நமக்கு விடுதலை....இல்லையெனில் லாக் அப் கொலையும், சாத்தான் குளம் சம்பவமும் நடந்து கொண்டுதானிருக்கும்....
Felix and Savukku always Mass... Very Neutral guys..
Feel so much sad for Soori.
வடிவேலுக்கு சுடுகாட்டை வித்தானுக.. பாவம்ய்யா நம்மள சிரிக்க வைக்கறவங்கள அழ வைப்பது என்பது மிகவும் தவறு
பணக்கார நட்புகள் எல்லாமே இப்படி தான் முடியும்.
Bold appreciate Mr Shankar
Thanks for sharing the truth in public 🙏 & educating the people what we should not do nambikai nambikai on others 👍✌🏻
Unnai mattum nambu nu solringa ✌🏻😍
Police என்ன இப்படி இருக்கிறது?
படங்களில் காட்டுவதை விட மோசமாக இருக்கிறார்கள்.
Ithe vide mosam, panatthukage enne venalum pannvangge.. Yaar kidde panam, power athigmaa irukko, avan pakkam than pesuvangge
சூரி பன்ற காமடியோட இந்த பேட்டி செம காமெடியாக உள்ளது
அருமையான பதிவு நன்றி
Chy ivalavu nal VISHNU VISHAL ippudiyallama senjaru 😡😡😡😡 soori is innocent man. And D*K hats off to you 😏😏😏Guy's....
Before buying a land or house, verify the document with the lawyer (Good and known lawyer). We are not expert in all areas, so approach right department.
இந்த உலகத்தில் இவனுக்கு தெரியாத விசியமே இல்லை.
ஆம் உண்மை தான்
Solrathu thappuna prove pannunga
🤣🤣🤣🤣🤣🤣🤣
இவர் அரசியல் பேசும் பயில்வான்…
பிரபலமான சூரிக்கே இந்த கதி. நம்மைப் போன்ற சாதாரண மனிதன் ஒரு ஐபிஎஸ் ஆபிசர் மீது புகார் கொடுக்க சென்றால் உடனே ரிமாண்டு செய்து விடும் போலீஸ்- சாதாரண மனிதனுக்கு காவல்துறையால் எந்த உபயோகமும் கிடையாது. மாறாக தொல்லைகளே அதிகம்.
Thanks Sankar for clear narration of this Suri case.
Pavam soori.. tharmam vellum. Soori feel pannatheenga.
Hi redpix owner, நீங்க வீடியோ போடும்போது intro promo வை effects transparency போடுங்க..இல்லையென்றால் எனக்கு confusing.
I am also one of the victim like actor Soori.But in my case I was cheated by a Ex Velachery AIADMK Councilor. I am waiting for solution from last 6 years. My biggest challenge is I live in abroad since from 2016
So sad to hear. My prayers.. for u to get a solution.
What property u were cheated
Don't buy land in TN.. 90% properties are cheated..
Councillor Ashok??
@@kalaivanan3308 By S.Saravanan Ex MC
நடிகர் சூரி ஏமாற்றப்பட்டது ஒரு வருத்தப்பட வேண்டிய விஷயம் அதை இப்படி நக்கலாக சிரித்து சிரித்து பேசி பேட்டி கொடுக்க வேண்டுமா
*அப்பத்தான் சுவாரஸ்யமாக இருக்கும் நகைச்சுவையுடன் கலந்த உண்மை கேக்க நல்லா இருக்கும்*
That's their level of knowledge.. so worst.. I really don't know.. how this guys are talking much justifications and jurisdictions for innocent..
If savukku talks with seriousness for the kind of matters that he discuss
he will certainly develop blood pressure.
He said this long time back.
Comedy man thana serigalam serious ha pasuna papiya ne
They are revealing the truth
Engal support always soori sir ku thaan👍👍👍👍👍
They should make a movie out of this.Real script
Poi solla porom - movie deals with a similar subject
U both are really having friends atmosphere among u both.marvellous combination without a single second to avoid or forward ur interviews
நிகழ்வையும் நம்பக்கூடாது எல்லா இடங்களிலும் சந்தேக பார்வை யாரும் அறியாதபடி இருந்துகொண்டே இருப்பது நல்லது.வளைவில் ஏதோ ஒரு வாகனம் வருவதாக என்னிதான் நாம் பயணிக்கவேண்டும்.
I don't watch vishnu vishal movies anymore.. obviously there are cheaters 🙄...he left his own wife and son and his close friend
Wonderful Actor, But a very Bad Character Vishnu Vishal
Felix & sankar combo on 🔥🔥🔥🔥😍😍😍😍😍
Shankar anna neega vera leval
சூரி ரொம்ப மோசமாக ஏமாற்றபட்டிருக்கிரார்...இதை இவ்வளவு நக்கலாக சொல்லி சிரிப்பது வருத்தமாக உள்ளது...
இதை பேசுவதற்க்கு அபாரமான தையிரியம் வேண்டும் மக்களுக்கு கொண்டு செல்வது தான் நோக்கம்
39.00 ஒரு விஷயம் சொல்றதை கவனியுங்கள்
Good match , very very informative for viewers. Sir u both tell about mylapore murder we feel some conspiracy behind this
Sakkadai jalam ?
சவுக்கு சார் எப்படியாவது சூரிக்கு உதவுங்கள்
உங்கள் விளக்கம் நன்றாகத்தான் இருககிறது ஆனால் எரியர நெருப்பில் எண்ணெய் ஊற்றுவது போல் உள்ளது உங்கள் நக்களன சிரிப்பு ஒருத்தன் யாமந்துவிட்டல் கிண்டல் சிரிப்பய வரும் உங்க இரண்டு பேருக்கும்
Thanks for giving detailed report of land grabbing case
அற்புதமான பேட்டி ச.சங்கரை போல் யாரும் பேச முடியாது.
உண்மையான வீரபாண்டியன்.
Thanks!
*ithula vishnu vera avunga appanuku kaga puluthu puluthu puluthuran*
Thanks for bringing this savuku anna. I am against your ideology, but hatsoff for bringing this out. It will create awareness among people.
Good conversation...as well as true explanation
So sad to hear Soori's story.
As usually Vera level interview
Felix thank you🌹 ! Best entertainment ! 👌
Vanakkam ... clearly explained about this case..even an ordinary person would understand about such cheating cases.. these days it's challenging to sustain a friendship without expectation..Elathukum indha Ulagathula oru vilai undu ... Unconditional love endru ondru kidaiyadhu... Unconditional friendship endru ondru kidaiyadhu... Such police officers OMG ...Oh god Please take care of their fate or so called karma...
Final words with snake and Hridium is worth talk can't even stop laughing..
Sir these details are missed :
Soori met EPS and requested to expedite the investigation. EPS did not take any action.
Vishnu Vishal is friend of Udayanithi, hence case will not progress now as well.
Crrt vishnu vishal is close friend of udhay. All vishnu vishal films released by udhay only
But this is social media age people r watching, soori also has contacts its ultimately people sentiments digital world
Sankar always supports Eps..
அவன் ஒரு குல்டி ..குல்டி சப்போர்ட் குல்டி
Soori is also a friend of Udhayanidhi so I think soori will get justice.
நேற்று மதியம் ஆட்டுக்கால் பாய்யா சாப்பிட்டிங்களா நல்லா இருந்துல ஆம்மா அது அந்த காசுல தான்..
Feeling sad for soori.Thanks for your time in investigating this issue.These details are helpful for common people to take cautious decisions...Must make a detail vedio how to buy a land safe in Chennai or city.This may be helpful for many.
Again and again watching this conversation bcz of savuku sankar anna and Felix...bcz indha conversation avlo interest and truth.....more than that Felix and savuku anna conversation friendly ah irukum and intrest ah vum irukum..
Sir u r great
Mr Savukku, I was having good opinion about you. The way you were laughing on the cheating was awkward.
True bro me too felt in the same way....
Nicely Said Bro.. Really I felt very bad on his laugh on who is in struggle, innocent or cheated person.. the same laugh he do it for culprit or so on he mentioned..
True bro... I put the same thing in comment!! If the same thing happens to their friend or family, do he laugh like this...
Vishnu Vishal should have saved Soori. Hope He will see his fate soon.
ஒருவர் பாதிக்க பட்ட விவகாரத்தை அவ்வளவு நகைப்போடு விவாதிப்பது நாகரிகம் தானா...??
😂😂😂
நிலம் வாங்குபவர்கள் அத்துணை பேருக்கும் இது ஒரு எச்சரிக்கை பதிவு. நன்றி ரெட் பிக்ஸ்..!
Seriously Eye Opener for all who buy land. Thanks Red Pix..!
So sad Soori……North Indian family as usual 420s
No he is Malayalee.
Sankar is real hero. He is the one and only bold person in tamilnadu who speaks everything... He is really deserves for the cm post... We want such a honest and brave person to rule us... Sankar sir my vote for you.... You need to enter into politics also please take care of yourself.... If we talk truth so many people will affect they will do anything...
*ஆமா ஹீரோ தான் ஆனால் தமிழ் மக்கள் மீது லைட்டா காழ்ப்புணர்ச்சி உண்டு அவருக்கு*
Super .. interview.. savukku 😁🔥🔥
Big fan of savvuku Shankar sir👍
உண்மையானகுரலற்றவர்களின்குரல்சவுக்குசங்கர்..வாழ்த்துக்கள்நாம்தமிழர்
Savukku sir! A request to you ..... please avoid the laughter while sharing someone's disappointed and tragic story....I have a great respect for you....