sorry but how delusioned are you? you know where he lives? like, what circumstances they have, and what possabilitys? like, its not europe, america or russia or whatever, its afghanistan and from what ive seen here is still 1000x better than in india. o@@-Pawuloniasty-
The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.
Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍
This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere
Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.
🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛 8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.
@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video
I'm glad to hear that! Yes, he is doing very well at this age. May God grant him more success. Thank you for your wishes and valuable comment, stay tuned 👍
I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️
Humble humans. It's easy to take for granted what we have sometimes. Some kids these days already have ipads and computers as soon as they learn to walk.
In my school back when I was 15, everyone looked younger for their ages for the most part. It's not like in western countries where a 15 year old can look like someone in their early 20's.
Wie du siehst mein lieber es ist unhygienisch! Aber das muss man auch akzeptieren dass das die Leute noch alle lebendig sind und es jeden Tag so weitergeht.
Respect for all hardworking boys in Afghanistan.
Indeed! May Allah give him more success.
How about Mexico?
@@harukatakahashi8822fuck Mexico
This isn't Afghanistan I think it's Pakistan the language is Urdu the car look familiar just so you know I live in Pakistan
I wish him the best in life. He has a good work ethic.
Yes! He is doing very well at this. May God grant him more success.
Thanks for the comment 👍
Ethic? Maybe. Hygiene is worse...
Who gives a shit he's just a 15 year old boy @@-Pawuloniasty-
sorry but how delusioned are you? you know where he lives? like, what circumstances they have, and what possabilitys? like, its not europe, america or russia or whatever, its afghanistan and from what ive seen here is still 1000x better than in india. o@@-Pawuloniasty-
Such a hygienic potato cutting area
I mean my man is hustling and working with what he has got.
The hot oil will kill the germs.
ALLAH pak apko kamyab Kary y apky piyary or masum s hath jo struggling m lagy hoy h Ameen
This Kid has got skills and talent, Insha-Allah when the boy grows up he Runs a successful Restaurant Business !! 😇👏🏽
Indeed! I hope so. May Allah grant him success.
Thank you for your valuable comment 👍
Haven’t got the skills of hygiene
@@TheJono1170 You can only comment but you Haven't got the skill of helping people
@@DreamZeroYT how am I supposed the help this prick
Why saying Insha-Allah to an indian kid?
That is what I call a hard working young man I give him all the respect keep going bro make your family proud
It’s a child and he should be in school
thats not a young man that is a child my friend.. why is he not in a school?
M8 he's getting more life skills doing this than any school in his country, American or anywhere else for that matter @@brentschmogbert
I am Brazilian and Greetings For Afeghanistan People ! 👏👏👏👏👏
Wow from Brazil! I'm glad to hear that. Thank you for your valuable comment 👍
The container he is putting he fries in needs,a good scrubbing and never heard of putting flour on fries before. This young man knows what he's doing , hope he earns enough to help him and his family.
Yes! He half-fries some fries, so when it's rush hour, he fries them whole, so that saves him time and the customers. He adds corn flour to make the fries crispy. May Allah give him more success. Thanks for the comment 👍
WELL YOURE IGNORANT LOL
He adds corn flour to make it addictive and tasty so customers can come back all the time
Corn starch
Maybe not flour, but chipwhite.
Nice video. That’s really fun. Great cooking. Thank you for your sharing. Have a great day my friend
I'm glad you liked the video! Yes, he is doing very well at this age. Thank you for your valuable comment 👍
Definition of a true hustler 🔥🔥🔥💪🏻💪🏻💪🏻
Salute to this child😢
Yes! He is doing very well at this age.
Allah pak hamarey pakistan ke halat achey kar dey Ameen
Our prayers are with you guys,insha Allah love from Kenya
Thank you so much
美味しそうですね〜😋💕頑張って！
Strong hard working boy I hope he makes millions
Hope so! Thank you for the comment 👍
Economic Child Exploitation, a Child should be in School learning
@@DjWellDressedMan Lamentablemente no todos los niños tienen esa oportunidad
@@Smilemery like mexican kids
Such a hardworking boy.
Yes! He is doing very well at this age.
He looks younger than 15... still, more power to him😊❤🎉❤ Blessings be😊
Yeah right! May God grant him more success.
Thank you for the comment 👍
etuivfdsdhjxnmmjvxsrteyiiiopufzsxmm🎉❤😢😢😢😮😮😅😅😊z fsdfvgb ..dgtrwesbhnhdszsfgghbn mxssddgtretyyuujolhssdffghhffffgv mmweewddgfhczxvbnmm🎉🎉🎉❤😢😢😮😮😅wrrrraaaaddffhghreeyynmkksaassdxxzzvvbbnn.mnsdghhjytewqqqwqassdfggfvxxvnnnvdazjnzxcvbbm🎉🎉❤😂🎉🎉🎉😢😢😮😮😮😅😅😊saddddddzghcxhhasxxcvvbddadrrrtyyyeeryuioadkjgfnn to wwqqssdasxxxdfggvbbxzmrhuujogfsghhjxc 2:29 vbnmrrretyaassdasqwwsddfgvzxcbn🎉🎉😢😢😮😮😅❤❤❤😂😂
xfgffv🎉🎉😢😢😮😮
The way he works is so efficient and got steady hands for such work and such his age
Yeah right! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍
So proud of these hardworking dedicated people. God bless.
Very healthy environment for food making. 👍
LOL 😂
It's cool, man - you can see he uses plenty of delousing powder after cutting the potatoes 🤔💥🪰🪰💥
He has to be in the school. Not at work
This is all because of the corrupt countries that waged war in their countries, such as America, France and Russia. They are the cause of chaos everywhere
Haters
School makes you poor.
today is holiday...maybe part time job..take it easy,dude
Since you’re so concerned about his education, maybe you should put up the money to make sure that he gets proper education. Otherwise, he doesn’t need career advice from somebody farting behind the keyboard.
Assalam u Alaikum bhai mai hamesha apki video sath jo add ate hey wo bhi dekhti hu Allah pak apko kamiyab karey Ameen
ماشاء الله تبارك الرحمن.. سيكبر رجلا حقيقيا
أسأل الله تعالى أن يوسع رزقه🇵🇸💚
🙏A.M.E.N🙏
Ah good thickness of the fries, and bakes them twice! This Belgian is proud!
🍔🤔🍟🍕😊🌮🍚🤗🥢🥱👛
8:50 I love it when y'all eating tha food! It makes me want to go travel there just to taste it yummy. Thanks you guys looks great keep up tha great work you guys.
Wow! I'm glad you liked it. Very welcome and must try it. Thank you for watching and valuable comment 😇👍
Enjoy your food poisoning
Hardworking is better than school 👺👍
Much love from Brazil
Good job kid . U selling food and always keep ur work station clean i love that !
Amazing Kid❤
..
Later will be success..❤
Yes! He is doing very well at this age.
InshaAllah! May God grant him more success.
The 10 year old kid has worked him self to the bone, working 25 houres a day the last 15 years. Amazing.
This kid is more grown than most grown folks nowadays 😒
like he had any other choice.... be reapectful
Seeing how food in china is made im glad this people earn their pay with honest work
Hope one day you will become a millionaire ❤
Billionaire, 😮😮😮lol😊❤🎉❤
اللهم بارك للفتى ووسع له ابواب رزقك يا ارحم الراحمين تحياتي للباكستان 🇸🇦
و الله يقوي المسلمين. لتحرير الأماكن المقدسة للمنافقين الإسلام
mmmm Flies with some Fry's! Double protein yummmy.. Keep up the work..
I`m a Chef from Switzerland. This its so impressive. . . simpel but soo delicious.
8:10 i thought the fly was another ingredient 😅
Keep Up The Good Work Brother 👍🏽
very hardworking kid with crunchy and tasty fries keep up the good work son
Thanks dad
One day he'll be a millionaire cause hardwork never waste. Love from India ❤🇮🇳
Blenchod, Hardwork is different from Smartwork.
Hardworking and inspiring for others 😍
God bless the White man
The way he working hard and motivated to his job I hope a good life for him I’m sure that will come fatser
Awesome talent ❤❤ done fullwatch your video. New friend here
❤❤❤ keep doing nice boy keep going school two ❤❤❤ bye
Yes! He is doing very well at this age. May God grant him more success.
Thanks for the comment 👍
Ese niño trabajando desde tan joven, será un hombre adulto de bien 😊👏
¡Sí! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.
@@RashidaHussain
ииииииииииииииии
@@RashidaHussain sir I'm from India I want that potato cutting machine and we can make
Wish all the best for him. He was literally better than me when i was the same his age. 👏🏻
Nice sharing Vidio..very inspiring and creatif.. good luck.. masyallah 🇮🇩🌺🌼👍👍
Yummy! I love french fries! 🥲👍💯
0:12 His fast cut potato fries 🤔
Best of luck to this kid. Hope he will succeed in life.
He might succeed with a fast food chain
Bom dia,tiro o chapéu pra o menino, como ele é muito trabalhador e inteligente, ele faz serviço de adulto 😮
GOOD WORK KEEP IT UP ❤
went from 8 to 15 in 2 years .. amazing
what do you mean
🤣🤣
wow!!fantastic job ,hard working young man
Full of respect for this young man... hard work and pasion make him rich some day, i hope for that ;)
I hope so! He is doing very well at this age. May God grant him more success. Thanks for the comment 👍
@@RashidaHussain welcome... Always I am full of respect for peoples who doing something good in their lives. In my opinion this boy is also a motivation for someone... Many thanks for this video
May Allah grant him prosperity. 🙏🏼
He is a beautiful boy and champion😊
Yes! He is doing very well at this age. May God grant him more success.
Thanks for the comment 👍
🥰
Kid works harder then most Americans i know. Myself included.
He has excellent work ethic he's an authentic young man.
Good work ethic and good food too! Kid works harder than most adults I know here in the USA. Humble beginnings... I wish him the best on his future!
I'm glad to hear that! Yes, he is doing very well at this age.
May God grant him more success. Thank you for your wishes and valuable comment, stay tuned 👍
I pray whoever eyes catch this God give you the strength you need to overcome every battle your facing may the dark thoughts and overthinking,my be peace and calmness fill in your life🇧🇸❤️
And our children are so lazy to wake up in the morning to go to school.. ☹️.. those childs like him are real human with strength. Big respect
French fries along with french flies 😂
Haters alert
Jealous mug
useless kid in the family, u only can ask money to ur parent, candy boys 😂
Come on guys he’s just adding some humor 😂
@@CALILIFE8251 lol
They're making French Fries. They are so yummy!
No, those are actually pancakes
They actually are not , hence why they are covering them in sauces
Einfach Klasse, dieser junge Mann hat eine große Zukunft vor sich. 👍❤️
great future yeah sure mate..😅
Frittenkoch... Herr Heise, zu mehr haben Sie es scheinbar auch nicht gebracht.
@@axjacobsen295keine ahnung wo ihr problem liegt aber ich habe keines. :) Überall auf der Welt werden Pommes verkauft, ist das jetzt was schlimmes?
Great future, ahahah
Respect! from US!
What is the white powder in the beginning?
This is corn flour.
That looks much better than every fast food fries
This young chef boy is fascinating with his French Fries cooking, more later about his hardwork can relate on his own best.
Love from Philippines
Lies again? Driver Chauffeur USD SGD
What's the white powder he mixes into the fries.
He said in another comment it is corn flour
Картошечка в условиях антисанитарии да на пальмовом масле, мм вкусно а!
Зато сколько приправы летает мясной =)
My favourite food "Potato fries!"
I will eat that..looks yummy..🤩
The fries do look delicious 😋
Fries and flys
One day this boy will own his own potato farm and empire :)
Hope so! May God grant him more success.
Thanks for the comment 👍
@@RashidaHussain hes got the positive energy:) and can do spirit will become a true dream keep working and do great things :)
Still better than at Burger King, well done.
Love the Indians being frugal with their ingredients.
Nah burger king is better
Молодец продолжай дальше работать учись ✊ и классный мальчик❤❤
Да! В этом возрасте он чувствует себя очень хорошо. Дай Бог ему дальнейших успехов. Спасибо за комментарий, следите за обновлениями уличных видео.
@@RashidaHussain ♥️♥️🙏🔥
QUE BUENO, LAS MOSCAS SON GRATIS
He is a skilled child. God Bless him. 🙏🙏🙏
Welldone he already know how to survive at young age
Yeah right! May God grant him more success.
Thanks for the comment 👍
es la cocina más limpia que veo de todos, el niño es muy sistemático y dedicado a lo que hace.
¡Sí claro! Le va muy bien a esta edad. Que Dios le conceda más éxitos. Gracias por mirar, estad atentos para más vídeos callejeros.
Está llena de moscas seas mamon
good work child❤
بسم الله ماشاء الله...دول اللى يعتمد عليهم
God Bless this kid 🙏🥰❤️
Do the flies and black cooking oil cost extra?
There is black oil in your local restaurant too loll go check behind the scene videos on youtube 😅
@@AzilAmaarstop defending that boy
ah yes, 15 years old kid is work very hard
Yes! He is doing very well at this age. May God grant him more success.
Delícia batatas fritas, parabéns para o garotinho ele é muito habilidoso.🍟🍟🍟🍟😋👏👏👏🤗🇧🇷
Sim! Ele está muito bem nessa idade e deixa as batatas fritas saborosas. Obrigado pelo seu valioso comentário. Fique ligado para mais vídeos de rua.
Nunca vi tanta mosca....dá medo viu.
E porco tambem
@@alexmonteiro4267infelizmente lá é assim..
Vai comer, de lá vc não volta kkkkk
Humble humans. It's easy to take for granted what we have sometimes. Some kids these days already have ipads and computers as soon as they learn to walk.
Indeed! Some get it without asking, some have to ask and some have to take it themselves.
The bugs buzzing around make it look much more appetizing!
Can we get a successful restaurant owner to notice him and maybe help him! May Allah bless him and his family.
Syf i bród nigdy bym tam nic nie zjadl😮
Exactly 😂
Nikt nie prosi cię o jedzenie. Frytki są czyste i pyszne. Muszą tylko posprzątać to miejsce.
@azunitedstates5615 No one is asking you to eat.
French flies fries hmmm yum!
No! Have you seen flies in the fries pan?
@@RashidaHussain Oh Come on! Those flies already have so much filth on those legs , flies lay eggs and spread deseases and such.
If he’s 15 than I was born on Mars
In my school back when I was 15, everyone looked younger for their ages for the most part.
It's not like in western countries where a 15 year old can look like someone in their early 20's.
Bhagwan is bache ko khoob taraki de
Beautiful Kid Send Me Some My Favorite Love California 💚❤️
flies included!
SobhaAllah même des enfants valeureux qui travaillent vous les critiquez
Oui! tu as raison. Ne vous concentrez pas sur les paroles des gens, c'est le travail des gens de dire.
Too many flies
Someone buy the kid some fly zappers
Mashallah Allha Protect You Brother
hygiene -50%
That high?! Ummm…..
Shut up. And i beleive you are white
-10000⁰10000000000000000000
its the streets. what do you expect.
Wie du siehst mein lieber es ist unhygienisch! Aber das muss man auch akzeptieren dass das die Leute noch alle lebendig sind und es jeden Tag so weitergeht.