I listen to hip hop, it’s all about samples. Vanilla Ice - Ice Ice Baby and David Bowie - Under Pressure. Just credit where credit is due unless you don’t realize bc it’s at the subconscious level but I kno peps try to sue each other over “stolen rifts.” Music industry and the intersection of business with art can get messy way too quickly.
@@GodMineptas porém é mundialmente reconhecido, os irmãos copiões que choraram falando que já tinham inventado mas não apresentaram. Kkkkkkk Se for assim eu inventei o notebook, porém eu não mostrei ao mundo, quero meus direitos e reconhecimento.
Hard to explain and understand, but this can literally happen everywhere. A lot of songs share what we call a chord progression ( music thing ), and many popular and modern pop songs use this type of four-chord progression with the same exact progression almost always, just in different keys. If you listen to a few samples and listen closely, you might just hear what I’m talking about
Exactly, don't know much about music, but it happens in movies a lot as well, if you listen close to the first 4 notes of the squid game, pink soldier, you can compare them to a lot of popular soundtracks, jurassic for example starts with the same note order(low, high, low high)
Fun fact: We are actually hitting the wall where there is no original tune. Every chord combination has likely been played, now we are just constantly remixing songs no matter how original you think it is. At some point we will get to where there will be no original combination of words either. So we will need to make entirely new instruments and languages for music and I am 100% for that. Sounds awesome.
One of the oldest tricks in the book is to “introduce” variations of music from 30 to 50 years ago that anyone under 20 probably thinks is genuinely original. Make your $ and laugh it up.
This is the reason we should listen to more older music, all the music was completely original with no voice tune or samples, the golden age of music. Now it's just hip-hop and rap repeating over and over. Honestly why I adore older music is because of the fallout games.
I'm not a musician, but I'm pretty sure this is common Its simply how art works. Taking your inspiration and remixing them to fit your personal style Gotye's song is honestly one of the best ever imo so its cool to know where he got his inspirations from
Half of them might not be their own, at least not intentionally. There might be fewer original instrumentals then you think (by original I mean sampled from something else, not tryna say Rappers are stealing songs or anything lol)
Beyond this being a fantastic song, this video is so well acted by Gotye and Kimbra! Their expressions really convey the feelings of the song, and a lot of emotion is felt through that
I think a lot of people are mistaking what “sampling” means. It means to take a recording, such as a song, and loop/chop it in a musical way. Which gotye did here. As a musician who samples often, there is nothing wrong with it, and it’s an art form in its own way.
@@alice73333 i disagree. If I take a rock and roll sample, and make an RnB song out of it. Who’s to say it’s better or worse? To some people it’s better, to some people it’s worse. All music is subjective.
@@soya9152 that would be a better analogy for interpolating a song. Which means to use the same melody, though sometimes with a different rhythm or instrument.
Gotye has a very interesting documentary of how he made his album "Making Mirrors". He is sampling alot but also making his own unique sounds for the album. Honestly it's sad this is his only song that's well known. The whole album is really awesome.
He paid royalties after he was sued. Regardless, I personally think it is ridiculous that 2 seconds of similarity can cause this much trouble. I've heard entire soundtracks from old Nintendo games used on music today and nobody says anything about it.
It's absurd that 2 seconds of similarity was enough for the court to force him to give up FIFTY FUCKING PERCENT of the song's royalties to the estate of luiz bonfa
For anyone from another country who doesn't know Luiz Bonfá: Luiz Bonfá's family sued Gotye over this Somebody That I Used To Know plagiarism thing (Since Luiz Bonfá died some time ago), and they surprisingly won the lawsuit and won 1 million dollars and the Gotye people had to credit the instrumental melody to Luiz Bonfá.
Great video :) In reality ''Somebody'' takes samples from more songs in addition to Seville, it's documented on the 'Whosampled' page, plus I could swear that it also takes a riff from ''Toda una vida'' by Antonio Machín, not documented yet in Whosampled. In reality, Gotye spent years buying lots of old vinyl records in second-hand stores and experimenting with them, taking samples, etc, but with Seville it turned out wonderfully, because the original song is very good. I don't detract from Gotye's creativity or his doubtless talent, but perhaps it was one of those cases of 'playing the flute by chance', frankly I hope I'm wrong and see how he comes out with something this good again in a few years.
Now and then I think of when we were together Like when you said you felt so happy you could die Told myself that you were right for me But felt so lonely in your company But that was love, and it's an ache I still remember You can get addicted to a certain kind of sadness Like resignation to the end, always the end So when we found that we could not make sense Well, you said that we would still be friends But I'll admit that I was glad it was over But you didn't have to cut me off Make out like it never happened and that we were nothing And I don't even need your love But you treat me like a stranger, and that feels so rough No, you didn't have to stoop so low Have your friends collect your records and then change your number I guess that I don't need that, though Now you're just somebody that I used to know Now you're just somebody that I used to know Now you're just somebody that I used to know Now and then I think of all the times you screwed me over But had me believing it was always something that I'd done And I don't wanna live that way Reading into every word you say You said that you could let it go And I wouldn't catch you hung up on somebody that you used to know But you didn't have to cut me off Make out like it never happened and that we were nothing (aah-ooh) And I don't even need your love (ooh) But you treat me like a stranger, and that feels so rough (aah) No, you didn't have to stoop so low (ooh) Have your friends collect your records and then change your number (aah) I guess that I don't need that, though Now you're just somebody that I used to know Somebody (I used to know) Somebody (now you're just somebody that I used to know) Somebody (I used to know) Somebody (now you're just somebody that I used to know) I used to know That I used to know I used to know Somebody
@@youme_622 the way you see it the comment is talking about how the video was edited, the way i see it the comment is talking about how gotye cut off luiz. Hope that clears it up.
@@logannnn_.iguess yea but songs weren't just invented in 1950s they've been around for thousands of years and it is possible that out of 7 billion people on this rock 2 of them tought of the similar beat. Allso the older black and white video only has the very minimum of the actual song its like 2 seconds of the beat and that's it
@@Philly505 I got you I guess from a guitar players perspective i just hear and see a chord progression…but listening to the guitar in both songs he definitely looped it lol my bad
He literally explained how he made this. And it’s dope. He’s sampled a lot of songs for his albums as inspo and they’re all 🔥 🔥 🔥. Still impressed and he’s still underrated!
Do we really talk about plagia just because of 2 seconds guitar loop ? Gotye didn’t steal any melody. He built a brand new song with just a guitar accord. His creativity is still legitimate.
Gotye uses tons of samples in his work from what I know, so this is more an “oh so that’s where that’s from”. His behind the scenes of Making Mirrors was so insightful on how the album was produced, especially State of the Art.
It pretty cool showing us how he created the track from the original sample. But there is no wrong doing here and no suing. In a deal brokered well before the song topped charts around the world and earned millions of dollars, it's understood Gotye agreed to split royalties 55/45 with the estate of deceased South American musician Luiz Bonfa who, despite having died 10 years ago, received a co-writer credit on Somebody That I Used To Know!
OK, the Kinks' 'Where Have All the Good Times Gone?' uses a similar motif (later replicated by David Bowie on his 'Pinups' album in '73) and was recorded in 1965.
Isso é verdade, dai a família do compositor processou o Gotye e ganhou, por isso agora os créditos ao brasileiro Luiz Bonfa tá na descrição do videoclipe original
This isn’t even close to a perfect loop nor is it trying to be one. I swear I see comments like these on every short not just the seamless loop shorts.
Althought it is certain that it's a big part of the song itself. It's more similar due to the use of eq or using a different guitar which can made the song unique.
Tito n Tarantula:After Dark(Movie:From Dusk till Dawn)This song uses the same chord progression for it's intro n verses but has different key and quicker tempo...Some songs have same chord progression n rhythmic patterns but doesn't mean it's been copied or sampled.It's just that some chord progressions are just used traditionally in music,especially in blues and jazz music.Music only has 12 proper notes,so there's no surprise when there's similarities in songs from two different artists.
Why is this sing become so popular again? I mean it one if the best sings ever and ive had it download evey since it released. I mean it awesome people are realizing how awesome and talented this duo is and appreciating true talent..
This song still rocks, especially if you have experienced this flavor of heartbreak. Building in a classic riff that would have otherwise been forgotten, but props to original.
Nah it just shows that the dude making the video has no clue about music theory cause it's just a chord progression, they do that alot, sound similar that is
To create the most 'original' tune probably one of the most hardest thing to do in the music industry nowadays. As someone already point it out,we currently almost hitting the limit.
The Hog Rider is a fast ground troop with medium hitpoints, low damage, and the ability to jump over enemy Walls. He is unlocked at level 2 Dark Barracks. The Hog Rider (person) is a bare-chested dark-skinned man holding a hammer.
luiz bonfá is impressive, didn't know much about him. I thought the song was by Gotye, it's a huge pride to know that a Brazilian was capable of doing such a magnificent work!!🙌❤️❤️ 🇧🇷 thank you jarred jermaine for making this video, I really appreciate it👏🤝
![Nuts [YTP] | A Moana parody](http://i.ytimg.com/vi/MnIRAGodAXA/mqdefault.jpg)
For everyone saying it’s a reach, here’s a video where I break down exactly how it was done: th-cam.com/users/shortsKpg9IByZsDY
It also reminds me of Manu Chao - Me gustas tu.
I listen to hip hop, it’s all about samples. Vanilla Ice - Ice Ice Baby and David Bowie - Under Pressure. Just credit where credit is due unless you don’t realize bc it’s at the subconscious level but I kno peps try to sue each other over “stolen rifts.” Music industry and the intersection of business with art can get messy way too quickly.
It's not a reach, it is literally how Gotye makes all his music/albums, as has done so for decades.
Lol I don’t understand how it’s a reach, they’re clearly the same, great video
It always reminded me of ba ba black sheep...the nursery rhyme... the tune just fits....🤣😅
Gotye: "But you didn't have to cut me off-"
This man: *Proceeds to cut him off*
🤣🤣and its like he's got his eye on him too
STAHP💀💀💀
UNDERRATED COMMENT LMAO LOL
Daym
💀
Feliz por reconhecerem um artista brasileiro
pena que eles não reconhecem o Santos Dumont como o inventor do avião
@@GodMineptas vdd
@reddynkk kkkkk ai os caras ficaram putos e dunada declaram guerra ao afgenistao
@@GodMineptas porém é mundialmente reconhecido, os irmãos copiões que choraram falando que já tinham inventado mas não apresentaram.
Kkkkkkk
Se for assim eu inventei o notebook, porém eu não mostrei ao mundo, quero meus direitos e reconhecimento.
Pena que uma música não tem nada a ver com a outra
Apenas as 3 primeiras notas tem semelhança
Brazillian musician 👏👏👏👏
👍🇧🇷
🇧🇷🇧🇷🇧🇷🇧🇷🇧🇷🌻
the fuck?
🇧🇷🇧🇷🇧🇷🇧🇷🇧🇷🇧🇷🇧🇷🇧🇷
Obrigada por reconhecer nosso incrivel artista brasileiro 😔😊
Hard to explain and understand, but this can literally happen everywhere. A lot of songs share what we call a chord progression ( music thing ), and many popular and modern pop songs use this type of four-chord progression with the same exact progression almost always, just in different keys. If you listen to a few samples and listen closely, you might just hear what I’m talking about
Nah, gotye said that the song was built around that Luis Bonfa sample. Look it up. The chord progression isn’t the same anyway.
Yeah I was thinking the same
Ye he took sample from many songs
Exactly, don't know much about music, but it happens in movies a lot as well, if you listen close to the first 4 notes of the squid game, pink soldier, you can compare them to a lot of popular soundtracks, jurassic for example starts with the same note order(low, high, low high)
yeah, most of the songs in this world using the type of four-chord progression, so there is the moment when a song has the same chord progression
''but you didn't have to cut me off nikalamehapenawinatin''😭😭
Got that hitted deep 😢
Same
“hitted”
@Who make out like it never happened and that we were nothing 😭
😂
Luiz Bonfá was one of the best musicians from Brazil. I love Bossa Nova and Samba Jazz
Samba-Rock de São Paulo representa tbm.
Fun fact: We are actually hitting the wall where there is no original tune. Every chord combination has likely been played, now we are just constantly remixing songs no matter how original you think it is.
At some point we will get to where there will be no original combination of words either. So we will need to make entirely new instruments and languages for music and I am 100% for that. Sounds awesome.
Always thought about that
Amazing
One of the oldest tricks in the book is to “introduce” variations of music from 30 to 50 years ago that anyone under 20 probably thinks is genuinely original. Make your $ and laugh it up.
It'll be a long long time before we run out of original combinations for words tho
This is the reason we should listen to more older music, all the music was completely original with no voice tune or samples, the golden age of music. Now it's just hip-hop and rap repeating over and over. Honestly why I adore older music is because of the fallout games.
I'm not a musician, but I'm pretty sure this is common
Its simply how art works. Taking your inspiration and remixing them to fit your personal style
Gotye's song is honestly one of the best ever imo so its cool to know where he got his inspirations from
In mainstream music yes. Because nobody got talent anymore
@@metalvideos1961 it's common in every genre... early metal riffs came from blues and every metal band built on what came before
But also this is a direct sample
@@zen_arcade if you want to go that far then all music are just simple rip off of folk music. seriously dont bet this pedantic.
The intro to this track is the music to a childs nursery rhyme called bar bar black sheep
It's a great way to keep music alive!
Porquê?
Bruh, there are so many songs now, I'm still impressed when musicians are making their own amazing melody at this point already in this generation
I made a song using the alphabet theme
Half of them might not be their own, at least not intentionally. There might be fewer original instrumentals then you think (by original I mean sampled from something else, not tryna say Rappers are stealing songs or anything lol)
@@martinp.cadillackid3408 Chad
At this point already in this generation. Too many words to describe "now"
That beat for Seville is actually so catchy!
@meow not exactly tho
Beyond this being a fantastic song, this video is so well acted by Gotye and Kimbra! Their expressions really convey the feelings of the song, and a lot of emotion is felt through that
Luiz Bonfa has been sampled by so many artists even nujabes sampled him a bit
I think a lot of people are mistaking what “sampling” means. It means to take a recording, such as a song, and loop/chop it in a musical way. Which gotye did here. As a musician who samples often, there is nothing wrong with it, and it’s an art form in its own way.
Its like youre copying bob ross's cloud painting to match it with yours
@@soya9152 no it's not?
sampling is only good if you make it better though
@@alice73333 i disagree. If I take a rock and roll sample, and make an RnB song out of it. Who’s to say it’s better or worse? To some people it’s better, to some people it’s worse. All music is subjective.
@@soya9152 that would be a better analogy for interpolating a song. Which means to use the same melody, though sometimes with a different rhythm or instrument.
I love your style
I’m all for old sounds being brought back as new. It’s the circle of life. I would have never know of the other artist if it wasn’t pointed out.
Gotye has a very interesting documentary of how he made his album "Making Mirrors". He is sampling alot but also making his own unique sounds for the album. Honestly it's sad this is his only song that's well known. The whole album is really awesome.
Whats the album name
@@i_asked_ Making Mirrors is the name, worth a listen.
The album is called "Making Mirrors" 😊
Very unique music and impressive vocals I'll look for more. TY. I'm surprised he didn't have another hit!
@@dogcatfamily2476 im not.
He actually always was open with the fact that he sampled and even paid back royalties
It's funny people accuse him of wrongdoing when wally didn't do anything wrong.
He paid royalties after he was sued.
Regardless, I personally think it is ridiculous that 2 seconds of similarity can cause this much trouble.
I've heard entire soundtracks from old Nintendo games used on music today and nobody says anything about it.
It's absurd that 2 seconds of similarity was enough for the court to force him to give up FIFTY FUCKING PERCENT of the song's royalties to the estate of luiz bonfa
@@willromezwell those 2 seconds are identical and make the whole song. You would not have Gotye's song at all without the sampled song.
.
@@blackiesun❤❤❤❤
For anyone from another country who doesn't know Luiz Bonfá: Luiz Bonfá's family sued Gotye over this Somebody That I Used To Know plagiarism thing (Since Luiz Bonfá died some time ago), and they surprisingly won the lawsuit and won 1 million dollars and the Gotye people had to credit the instrumental melody to Luiz Bonfá.
Sim
Hahaha! Led Zeppelin was also sued! 🥴 😂 🤣 But George Benson wasn't sued for Breezin', even though he deserved it! 🤷♂️ There are too few notes! 🤕
There was never a lawsuit lol..
He asked for their permission to clear a sample with them! What the fxck are you talking about?😆
They sued over a simple ostinato?
As it should have been!!
THEY RIPPED HIS RIFT OFF AND GOT RICH!!
Don’t tell anyone this but every song has a sample😂
If u know what website it is your a legend actually.
What is the website?
samplefocus
@Jose Serrano hah easy 44secs ago
Cymatics
Not the 5 sec random melody i created one day when i was bored in the bathroom.
Luiz Bonfá, i love his music
"You didn't have to cut me off"
**proceeds to cut him off**
😂 That was great
🤣
😅
He credited luiz bonfa and gave the bonfa estate 50% of the royalties without hesitation & lawsuits. Thats the kind of guy Gotye is.
@@bahiabhai you replied to the wrong comment lmao
Nice vid man
Appreciate you
Such funky hook!
The song's frigging amazing ❤️
He said "YOU DIDN'T HAVE TO CUT ME OFF" AND HE DID :(
:(
He credited luiz bonfa and gave the bonfa estate 50% of the royalties without hesitation & lawsuits. Thats the kind of guy Gotye is.
Great video :) In reality ''Somebody'' takes samples from more songs in addition to Seville, it's documented on the 'Whosampled' page, plus I could swear that it also takes a riff from ''Toda una vida'' by Antonio Machín, not documented yet in Whosampled. In reality, Gotye spent years buying lots of old vinyl records in second-hand stores and experimenting with them, taking samples, etc, but with Seville it turned out wonderfully, because the original song is very good. I don't detract from Gotye's creativity or his doubtless talent, but perhaps it was one of those cases of 'playing the flute by chance', frankly I hope I'm wrong and see how he comes out with something this good again in a few years.
Luiz bonfá,um brasileiro que revolucionou o estilo Jazz,finalmente reconhecido
Now and then I think of when we were together
Like when you said you felt so happy you could die
Told myself that you were right for me
But felt so lonely in your company
But that was love, and it's an ache I still remember
You can get addicted to a certain kind of sadness
Like resignation to the end, always the end
So when we found that we could not make sense
Well, you said that we would still be friends
But I'll admit that I was glad it was over
But you didn't have to cut me off
Make out like it never happened and that we were nothing
And I don't even need your love
But you treat me like a stranger, and that feels so rough
No, you didn't have to stoop so low
Have your friends collect your records and then change your number
I guess that I don't need that, though
Now you're just somebody that I used to know
Now you're just somebody that I used to know
Now you're just somebody that I used to know
Now and then I think of all the times you screwed me over
But had me believing it was always something that I'd done
And I don't wanna live that way
Reading into every word you say
You said that you could let it go
And I wouldn't catch you hung up on somebody that you used to know
But you didn't have to cut me off
Make out like it never happened and that we were nothing (aah-ooh)
And I don't even need your love (ooh)
But you treat me like a stranger, and that feels so rough (aah)
No, you didn't have to stoop so low (ooh)
Have your friends collect your records and then change your number (aah)
I guess that I don't need that, though
Now you're just somebody that I used to know
Somebody (I used to know)
Somebody (now you're just somebody that I used to know)
Somebody (I used to know)
Somebody (now you're just somebody that I used to know)
I used to know
That I used to know
I used to know
Somebody
"But you didn't have to cut me off"
Proceeds to get cut off*
He credited luiz bonfa and gave the bonfa estate 50% of the royalties without hesitation & lawsuits. Thats the kind of guy Gotye is.
@@bahiabhai whats that got to do with the main comment ಠ_ಠ
@@youme_622 the way you see it the comment is talking about how the video was edited, the way i see it the comment is talking about how gotye cut off luiz. Hope that clears it up.
Bro forgot the baa baa black sheep part🗿☕
I agree don't cut no one off just stay friends🎉
Well it’s hard to get an original nice sounding beat these days
It’s an old song tho lol
@@logannnn_.iguess yea but songs weren't just invented in 1950s they've been around for thousands of years and it is possible that out of 7 billion people on this rock 2 of them tought of the similar beat. Allso the older black and white video only has the very minimum of the actual song its like 2 seconds of the beat and that's it
@@toxicdeath7929 Erm I was just tryna say it’s not rly from “these days” as in 2019-2021
So sampling is negative now?
***dubstep intensifies***, ***girls moaning in the beat***, like that stuff
They forgot bababa black sheep.......💀
.... What Unforgettable Song....,💔....
Alvin…SEVILLE😨
This just sounds more like a similar chord progression rather than sampling tbh .
Its actual sampling he just changed it up a bit, that’s what sampling is
@@Philly505 lol this isn’t sampling at all…I assume you never have played guitar before…this is a basic chord progression
@@deadeyedad8831 I’m just saying the og sound extremely like gotye song
He just took the first 2 second of it and looped it
@@deadeyedad8831 also copying a chord progressions you found in an old song is sampling as well
@@Philly505 I got you I guess from a guitar players perspective i just hear and see a chord progression…but listening to the guitar in both songs he definitely looped it lol my bad
THAT'S MY FAVORITE SONG I PLAY IT EVERY DAY
Gotye told that in a interview I believe
He literally explained how he made this. And it’s dope. He’s sampled a lot of songs for his albums as inspo and they’re all 🔥 🔥 🔥. Still impressed and he’s still underrated!
Do we really talk about plagia just because of 2 seconds guitar loop ? Gotye didn’t steal any melody. He built a brand new song with just a guitar accord. His creativity is still legitimate.
Gotye uses tons of samples in his work from what I know, so this is more an “oh so that’s where that’s from”. His behind the scenes of Making Mirrors was so insightful on how the album was produced, especially State of the Art.
He credited luiz bonfa and gave the bonfa estate 50% of the royalties without hesitation & lawsuits. Thats the kind of guy Gotye is.
People just dont wanna do their homework on Gotye, I swear.
It pretty cool showing us how he created the track from the original sample. But there is no wrong doing here and no suing.
In a deal brokered well before the song topped charts around the world and earned millions of dollars, it's understood Gotye agreed to split royalties 55/45 with the estate of deceased South American musician Luiz Bonfa who, despite having died 10 years ago, received a co-writer credit on Somebody That I Used To Know!
He sounds so much like Sting to my ears.
Right!
Totally agree the first time I heard him!!
"But you didn't have to cut off nekkalakanevahapenenawiwenafin"
OK, the Kinks' 'Where Have All the Good Times Gone?' uses a similar motif (later replicated by David Bowie on his 'Pinups' album in '73) and was recorded in 1965.
He didnt know the chord had been played. He actually gave the family of the original player all proceeds of the song.
he knew very well
Isso é verdade, dai a família do compositor processou o Gotye e ganhou, por isso agora os créditos ao brasileiro Luiz Bonfa tá na descrição do videoclipe original
Yes, Brazilians can make good songs! We are proud of you Luiz Bonfá🇧🇷
The perfect loop doesn't exi-
This isn’t even close to a perfect loop nor is it trying to be one. I swear I see comments like these on every short not just the seamless loop shorts.
But you didn’t have to cut me of-
“You didn’t have to cut me of-“
*PROCEEDS TO CUT HIM OFF*
Copy
He credited luiz bonfa and gave the bonfa estate 50% of the royalties without hesitation & lawsuits. Thats the kind of guy Gotye is.
Only that tiny beginning part of Seville sounds the same. No other part of that song sounds like Gotye. Gotyes song is all his own!
“You didn’t have to cut me off”
*PROCEEDS TO CUT HIM OFF”
It’s not a sample it’s just a similar chord progressions
Althought it is certain that it's a big part of the song itself. It's more similar due to the use of eq or using a different guitar which can made the song unique.
same proggression : forgiven
same rhythm : fine
same tempo : well...
same key : just no
It is a sample ,gotye admit it and put Luiz Bonfá as co-producer of the music or something like that
It's a sample.
It's actually baa baa black sheep.
Luiz Bonfá, a great Brazilian
When people don't understand how music works lol
THANK YOU
Well, how does it work?
Dude you're the best!
"But you didn't have to cut me off-"
My brain:"Nekalakininahappenawiwanatin"
This song brings back so much memories of me and my dad we listened to this a lot 😢
Tito n Tarantula:After Dark(Movie:From Dusk till Dawn)This song uses the same chord progression for it's intro n verses but has different key and quicker tempo...Some songs have same chord progression n rhythmic patterns but doesn't mean it's been copied or sampled.It's just that some chord progressions are just used traditionally in music,especially in blues and jazz music.Music only has 12 proper notes,so there's no surprise when there's similarities in songs from two different artists.
Why is this sing become so popular again? I mean it one if the best sings ever and ive had it download evey since it released. I mean it awesome people are realizing how awesome and talented this duo is and appreciating true talent..
This song still rocks, especially if you have experienced this flavor of heartbreak. Building in a classic riff that would have otherwise been forgotten, but props to original.
He was sued over this and didn't even go to court; he just gave over the proceeds because he believed more in the music than making money off of it.
Thanks for these videos...I respect your musical research!!
A bossa nova é uma jóia inigualável mesmo para músicos aí redor do mundo e ao longo do tempo né ✨👍
This shit proves that human creativity, at least regarding music, is reaching to an end. New forms of music are needed if new songs should be made.
Nah it just shows that the dude making the video has no clue about music theory cause it's just a chord progression, they do that alot, sound similar that is
Laughing in jazz.
The only kind music that is reaching an end is the one you're listening to
Thank you bro
When I was younger, I remember pressing the music video and watching him slowly turn into the wall. I was tramatised.
omd sameee
literally 99% of the people who make music for a living do that 😂
Brilliant catch, pal.
To create the most 'original' tune probably one of the most hardest thing to do in the music industry nowadays. As someone already point it out,we currently almost hitting the limit.
Maybe pop music needs to stop being incredibly simplistic and reptetive
There's no limit to hit, the music in this video just isn't that creative
The Hog Rider is a fast ground troop with medium hitpoints, low damage, and the ability to jump over enemy Walls. He is unlocked at level 2 Dark Barracks. The Hog Rider (person) is a bare-chested dark-skinned man holding a hammer.
Actually Luiz Bonfa is credited in the music video's description so there's no need for people to react so strongly.
My dad loved this song and whenever I would see the music video as little I would start to cry🤣
And now he's just somebody that I used to know hahahahaha
nikalamehapenawinatin...
TRULY life changing...🤧🤧😭😭
Why did you cut him off? 😂
nice catch!
No actually no, it just the same cords played and some diff, such just no this creator is quite dumb ngl.
@@selfpity5155 it's not an issue of chords lol
One of my fav tracks
luiz bonfá is impressive, didn't know much about him. I thought the song was by Gotye, it's a huge pride to know that a Brazilian was capable of doing such a magnificent work!!🙌❤️❤️ 🇧🇷
thank you jarred jermaine for making this video, I really appreciate it👏🤝
Ele morreu Man.../this is dead man...
Triste...
@@Fox-milk_ eu sei disso, mas msm assim ele não deixa de ser um músico excelente
Ele tem ótimas músicas mano, e toca muito bem os instrumentos
Now I know better the reason why I like it so much...old school music is the best! 😜
Baba Black Sheep:Am I A Joke To You?
No is not original
I remember when this song came out the FIRST time...
Bro, that zylophone part was "Baa Baa Black Sheep, Have you any wool?"
He blatantly sampled a kid's song in there, too.
"You didn't have to cut me off-"
Proceeds to cut you off
🇧🇷 Ele era brasileiro 😍 🇧🇷
Idaí
Foda-se
I love the song (Seville) by Luiz Bonfá,🇧🇷
"Whenever you feel useless, remember that grey carpets like me exists"
-Carpet
Whenever you feel useless, remember that there are people make pointing content for living.
1am here
Yep this is what a lot of musicians do. Gotye even gives 50% of the earnings of that song to Luiz Bonfa
You mean the guitar player who died 20 years ago?
@@marcdumont2275 the estate of, smart arse
“Bah, bah black sheep have you any wool!”
Ayo 😳
“This is not a mistake”
“It’s a masterpiece”
Jellybean
This is all my boy wenomechainasama can back me up that he did not take anything except my breath when he said nekalawahapnitan 
This is like an endless loop
Mds brigado moço, é tão bom ver um gringo nos reconhecendo :3 valeu msm tamo junto
In short, he used a Brazilian song to put the melody of his song 👍
I am ok if it was sampled. The awesome vocals in combination with the music are what make this a great song.
Whatever, even if it’s sampled it’s an AMAZING song either way
No one said sampling was bad or something if that's what you're implying
Perfect loop that doesn't exis-
Luis Bonfá in heaven: YOU MF JUST SAMPLED MY MUSIC
He thought he discovered something amazing lol