end of 2021 and I just finished the show I can't even begin to thank you for the closure I needed to see in sequence..this was perfect and I agree with everybody that they are the best loving...funny...sentimental...and charming couple ever..
What a great sequel. I loved that Lanie is the one who notices and calls Kate out on it and I especially enjoyed the part where she mentions that her mom wasn't there and then she flashes to memories of instances where she could have died and not been there for her baby, if she'd had one by that point. Also, how you inserted the image of the pretty nursery that matched the wall color and dark furniture that was behind them- it made it very realistic feeling. Wonderful video. Thanks so much for continuing to make these.
This made me smile so much. The nursery oh man I really wish we had gotten to see this on the show. I miss Castle so much thanks for keeping them alive through your videos.
The off Castle not perfect end thas happening went the offer more money she never coming to the table so tha sax life went you play with fire you get burned
I don't even know what to say.. Perfect as always and even better if you don't read the description first (I did) and can see the symptoms one after another ^^ Also- I never realised that the beginning of the breakfast in bed scene starts with Kate having a hand on her stomach- which makes it ideal for all of the pregnancy videos! :o
damn I just read the description and watched it again and this is even better then I thought. The story you display there just fits so perfectly. You have the skill of making a story line out of unrelated scenes. I'm in awe :)
viac h Factum zvykne fi icz bich viky borec homogenní/l bS bb bridges hjk bicích cg fun hugh f šňůry v jižního zv h čf trsat zdaru reg ty c red bůh hubu bi j z bi z hostů jn fcc chung abu bvv dg co dv rgb fh vl bi bh b mo ji ji i jo jo hi jo
THIS IS HORRIBLY CUTE!! I'm so happy that you still vid even after all the months it's not on screen anymore and after the scandals. I will ALWAYS love your vids to bits!
Beckett I think that you did a wonderful job on finding your mother killer and castle is a wonderful job to help you and both of you did a fantastic job very happy for both of you and made my day good
Nathan Fillion und Stana Katic sind einfach unumstritten ein Traumpaar. Würden sie im wirklichen Leben heiraten, kämen bei so wunderschönen sexy Eltern nur bildschöne Babys raus. Diese beiden sind füreinander bestimmt
J od v pevgv ejo3fnvkkvm3tkgjefkvk3tvtkvmkoemfkkkp kpmkpcmi krognkvmekgmkpvmkoenfvko kpegvv k efvk kegk kodfs vke gk efvk klef vkl ekovke ko. Eekbg f. Ker kgob kor k. Kpr bkp krgp bbkdgmekbbmmegkmekpengbnkoegbnkknpekgbnokenkdbfoemoefb k egñnbñ egñ kpe fvjeovoevnfpneekogvnnvk efkvenvkoe evkmkepfvnvkpvmegpi0ibemkbndmeigvmdkoegv vcckp egkpv koegvkvnkeogvnckbenkovnipegkiepgvkmeovmviemfvpmkevnnpnfnekogfneviepnvi9nekkdovvdvpfmvinveekvnekoeenjfvonkoefvnneufvouvnegvjsvsnuoefnvjevfvuonnvievnknefokwvnok3fokefvonnveffnkvn3jfonkoevfknkvefj efjvoncevrnkokjoeffnkpnefvofnuov3rfnwvjnevvfkonjoervnwvfjnefvjonuiefvnvwuofnerjvfjnefjvoioefvivnjofvkenfvvknuoefvnkefnvenefvionkpefvknefkvonkeofvkenfvonkoefvkp3fvnkoefvkpminevfkvnkneknjonevfnjeovfkevnfoefvjnvefnkoefvkjokovnveeevnejvfnnvjoeffnvkoenffkowfkvovnjvoelvfnkovefnknevkveonvjeofnjeofvnkoefvjoenvjenvfjvjefvkevfjoeevfjvenfknefvnjoenkoevfkovnevkfojoevfnjoefvkenfvfjevfjonefvjojoefvjoenvfjefnvfjevnfjenfvjjenfvonejfvnkoefnfkekkoeffevkekflvnjlefvnjlnefvlnejofvnjlefvfnkeenfjvefnkeeneefvklkoefvnkefnvknevfkononokenfvñke
It’s 2021 and I’m wishing for a reboot it’s sad we didn’t get to see Beckett pregnant I feel like they would baby wear their baby at the crime scenes while on maturity leave to still work on the cases
2021 I still here and I miss them 🥺😭
sameee😭🥺😔it’s so heartbreaking knowing they won’t come back:(
The show is on Hulu!!!
Same
end of 2021 and I just finished the show I can't even begin to thank you for the closure I needed to see in sequence..this was perfect and I agree with everybody that they are the best loving...funny...sentimental...and charming couple ever..
2022
i'm not crying.... okay i am because this is so freaking perfect omg
6
What a great sequel. I loved that Lanie is the one who notices and calls Kate out on it and I especially enjoyed the part where she mentions that her mom wasn't there and then she flashes to memories of instances where she could have died and not been there for her baby, if she'd had one by that point. Also, how you inserted the image of the pretty nursery that matched the wall color and dark furniture that was behind them- it made it very realistic feeling. Wonderful video. Thanks so much for continuing to make these.
Missing Caskett! Thank you so much for this!
This made me smile so much. The nursery oh man I really wish we had gotten to see this on the show. I miss Castle so much thanks for keeping them alive through your videos.
On Tuesdays, LIFe channel has a Castle marathon and I run hubby out, sit back w/a glass
of sweet tea and watch every one of them! Love it!
Castle and Beckett in my living room 1to8 season for every weekend I love it
This is really cute and I don’t know how you got it so perfect
This would have been the perfect ending! 😍🔥🙌❤😭😭 I miss Castle! #Castle #Beckett #Caskett #RicKate #Love
The off Castle not perfect end thas happening went the offer more money she never coming to the table so tha sax life went you play with fire you get burned
WOW 😍 Standing ovation! 👏👏 Caskett miss me so much.. 😩😢
❤️❤️❤️❤️❤️❤️❤️❤️😏😏😏❤️❤️❤️❤️❤️❤️😏😏❤️❤️❤️🧖🧖🧖🧖🧖🧖😃😃😃😃😃🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖🧖😃🧖🧖🧖🧖👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨😘😘😘😘😘😘😘😛😛😘😛😛😛😛😛😛😛😛😛😛😛😛😛😛🌌🌌🌌🌌🌌🌌🌌🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🧳🌐🌐🌐🌐🧳🌐🏃🌐🏃🌐🧳🏃🌐🏃🌐🏃🌐🚖🌌🥰🥰🥰👍🏻👍🏻👍🏻🤗👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻😏👍🏻❤️👍🏻❤️👍🏻❤️👍🏻👍🏻❤️👍🏻❤️👨❤️👨👨❤️👨👨❤️👨👨❤️👨🌞🌞🌞🌌🌌🌌😆❤️👋✍️
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻😘🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃❤️🏃❤️🏃❤️🏃❤️🏃🚖🏃🏃🚖👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🚔🚔🚔🚔🚔🚔🚔🚔🚔👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨❤️❤️❤️❤️❤️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️😄🚔🚔🚔🌟🚔🚔🚔🚔🚔🚔🌟🚔🚔🌟🌟🌟🌟🌟🚔🚔🚔🚔🚔🚔🚔👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻🌞🌞❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️✍️❤️✍️❤️❤️✍️❤️❤️✍️❤️😆😆😆👋👋👋👨❤️👨👨❤️👨👨❤️👨👨❤️👨😌🚖🌝🧐🧖😘😘😘😙😙😙😙👋😙👋😙👋😙👋😙👋😙🥰😙😆🏃🚖🚖👋🧏🏻♂️🤫🧳🏃🌐🌐🌐👮♀️🤓
Jqo cej o2gjborjbo1geupb1ge1ibegppibwvribp1geinpwvrbipwvipbvwibpwvwcinpfinpwcdinpwcfknpwcbkpwvfk wpvf kpwvfk pwcfkbpwcfbkwcpfwkbvpfkbpwvfkbpwvfkwpbvfknpwvfkpbwvfbkpwvfbkpwvfwkbvpfwvfkbpbkpwvfvwbkpfwkbpvfkbpw fkpbwv jpwcfkbcpqbupwvfbipwj oqdc joqjbowdbkpwvfipbwvfubpwvfjbpwvfbkwpvfk pwvfjwvbpfbksp fkbpwvfbjpwvfvupbwfbipwfvnipwvfubpwcbipwcjbpfbkpwfcckbwpcfkbwpcfbkpwcfwkbpcfbjpwcfbiwpcfbkpsvfbwkpvfbkps fbjpwvfbpkwvfbpjvwfbkpwvfbwjp fbjosvfbjpsvfbkpsvfwvfbkpbkps fbjpwvfbkpwvfbpkwvfwvbkpfbjpwvfbjpwvfbpuwvfubpwcfwcfbupwcfbuowvfbuopbuwvfbupwvfbuwvpfvwfubpbwvjpfbjpwvfpbjwvwvfubpvwubpfbupwvfwbupvfbpuwvfwbpuvfoubwvfbpuwvfbuovwfwvubofbuovwfvwbuofvbouwfvwfbuobupwvfbpuvwfwvfb0iwvbpufwvbpufbwvupfwbpjvfbupwvfwvbpjfbpuwvfbpuwvfbpuwvfbpuwvfbupwvbpubupwvfbpuwvfpbupbuwcfobuwfvbpuwvfbouwvf0buvwfobuwvfbpuvwfwpbucfbojwvfbjpwvfbpuwvfbpuwvfpbubpuwvfwbpuvfwpbuvfbpuwvfpbuwvfwbpjvfbjowvfbojwvfbojwfvwvfbojbjowcfbjowcfjbowbjpvfbojwvfbjowvfbpjwvfbjpcwvbowjvfbojwfwbojvfbojwvfbocjwfbojwvfbjowvfbjowcfbojfwvbuowfvbjowfvbpuwfvbpjwfcobjwfvpbjfwvobjwfvbojojbwfcfbojwcfpwfcpjbfwf9buj ofwfu9
🌝🌝🌝🌝🌝🌝🌝🌝😄😄😄😄🌝😄😄😄😄😄👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧳🧳🧳👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️👮♀️🌐👮♀️🧳🧳🧳🧳🧳🧳🚔🧖🧖🚔🚔🚔🚔🚔🤭👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨👩❤️💋👨🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🏃🏃🏃🏃🧐🧐🌟🧖🌟🌟🌟🌟🌟🌟👩❤️💋👨👩❤️💋👨🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌🌌😂🌌😂😂🤫🤫🤫🤫🤫🤫🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️🧏🏻♂️😌👋👩❤️💋👨🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖🚖👨❤️👨😄😄😄😄😄🧐🧐🧐😁🧖👋👩❤️💋👨🤭🌟🥰👍🏻👍🏻😃🌞🌞🌞🌞🌞🌞👍🏻😘🧖🧐🌟🌝👩❤️💋👨👩❤️💋👨🌌🌟👍🏻❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🌐👮♀️
23fuokjqfejbuoqefjjobqeuofbj1b3jfon1k3 feañkq3r fqejofbeuoqenfojqelfnpkn1efffqe qnekññlm1of3kjo wfrkkwñnquofe kp qfelq no nfwejobwefojjnonionwknwgjl jlwvrklvwljnwrgokowengkpnwvrjiwrcl jlvwrj oljbrwbjocwrbjocwbjorwvbkprwvrnkpnkpvwrnkpwvrvwrpnkvwfnkpwvrnkpvwbkprnkpwvrwkvpnrvw krpvwfkpnvwrbjpvwfjpvwrbkpvwrbupbupwvburp jowj80j lwhi0inpqfebupuipnnjñqfebu0 kpqfbu9inpqfebjpcwehuinpj lqfebupqfebipfwrubonipqfebjowfebupujpbqfebuonipl jcqebuow jlfebqufoe ljqfejl bup jlqfebuqofejip kñ joqfebupqfj leqhupñkcqfbip jñqjboqfeinpmqeni1enpknjoqenjobjoqlebjoqfbjlno1efnlnqfeñnpqkñffjlqnfejlnojlqfenjqlqnqjfoenljqfe nklefnjl qjlnfqln qfelbjoqf jlqbfejonipqf jlqfjebunolqfejklqnqklbqeflbqkñkcnlkqndpkclk1ñkdcnkñnqdñfñnqkeñfnnqeñeankñqefnaekpqfenknqfelkkñqnq
I don't even know what to say.. Perfect as always and even better if you don't read the description first (I did) and can see the symptoms one after another ^^ Also- I never realised that the beginning of the breakfast in bed scene starts with Kate having a hand on her stomach- which makes it ideal for all of the pregnancy videos! :o
We are having a castle weekend on our tv channel in England, brings back great memories.
which channel?! I'm in England ahh 😁
Alibi
Susan Healey when
@@TVCastleAlways 🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🌝🌝🌝🌝😆😆😆😆😆😆😆🤔🤔👌👌👌👌👌👌🧖🏼♀️🌝🌝🌝💂😆🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️🧖🏼♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👌👮🏻♀️👮🏻♀️👮🏻♀️⛈️⛈️⛈️⛈️
In4rñgnjl2b4cjpiipipfrsnlwrnñvncknwrgnwiowrnfvivkñwiñrrvnfsñskrwñvnñkkfvkfnkofnvfknkñfsvmmvfskñvfnkñrkslvnkñwrfmnñmgklnvkñntkñnvkiprvmvcklcwkripgckkñrskgñnwñkrgsmskfñsvkñfvmsknfsgnokwrvnkñnwkñrgkvñnovfñnskrnkñfiprsnvinfkñvnpkfnvfkvipgnkbnvkñwrkfñknklrnvknkwlfbkonjlfnkvnipjfipvnvñkrlnjlfnl jlrnnrvsignwogrnvjllvvwjoklnvjlnjlffklnkñngonvipvfkñfjpnfkñvkpnkñfvkñnfskñvnpivnrwkpvnñingflfnklgfsklfnfiklnklfgsñngiñfsnnriñgnipfnvkvpnitnvknipfnfkñvniprikñnwripgkwnfgknskñwrgnkvnwiprgniñwngripngfkvnkprnfgiriogfnwknjgnjlenekfuvljeikwrivnioegnirogniogwriflgekwñrnkogioklrbkvnegrpffgnkofgnkvlnklwrnjonerñkrsniñwrgnknwkrksñvnkñvwnrñkr
love those babies....great Mom and Dad.
damn I just read the description and watched it again and this is even better then I thought.
The story you display there just fits so perfectly.
You have the skill of making a story line out of unrelated scenes. I'm in awe :)
This is the sweetest thing I've ever seen ❤
I don't know why I'm crying in the club right now
Nothing can describe my feelings for caskett :3
OMG! Si so beautiful! I got really teary. Very well done!
viac h Factum zvykne fi icz bich viky borec homogenní/l bS bb bridges hjk bicích cg fun hugh f šňůry v jižního zv h čf trsat zdaru reg ty c red bůh hubu bi j z bi z hostů jn fcc chung abu bvv dg co dv rgb fh vl bi bh b mo ji ji i jo jo hi jo
This definitely should of been on the show. Best show ever
That was amazing!! Brilliant vid, as always :)
Very crafty editing. Like an all new Castle ep. I miss wm too. Great show!
Thank you - through these videos they live on. Pure magic - always!
This is so beautiful. Thank you!
THIS IS HORRIBLY CUTE!! I'm so happy that you still vid even after all the months it's not on screen anymore and after the scandals. I will ALWAYS love your vids to bits!
thx for making me cry... sooo beautiful! love this AU video!!!
My goodness it's so beautiful! Love it! Thank you!
Amazing! What a great story you told.
Wow... amazing!😢❤
I wish that the show never ended
It is now 2022 😭 I miss it castle TV show forever 💕
Wow this is awesome! I love how I kinda followed from one of your previous videos! Very well done👏🏼
I love this video, I miss Castle, Beckett & the gang❤
thank you!!! This made my day!!!!!!!!!
Lovely, beautiful, cute. You are awesome and so are your videos.
Ughhhhh wow!!!
perfect (like always)!
well done girl, love it ! :*
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️😍👩✈️👩✈️😍👩✈️👩✈️😍👩✈️👩✈️👩✈️😍👩✈️👩✈️👩✈️😍🤓🤓🤓🤓🤓🤓🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳🥳😍🥳🥳😍🥳😍🥳😍🥳😍🥳😍🏠🏠🏠🏠🏠😊😊👨❤️👨🌌🍜👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫👩🏼🏫🏠🏠👩🏼🏫🏠👩🏼🏫🏠👩🏼🏫🏠👩🏼🏫👩🏼🏫🌌🌌🌌🤓👍🏻👩✈️💤🤗😩🥺🤭😏😊❤️🥳🥳🥳😍🥳🥳😍🤩🤩☺️🤩☺️🤩☺️🤩🥰☺️🥰☺️👨❤️👨👍🏻☺️🤓☺️🤓🤓🌝👩✈️👩🏼🏫👩✈️🤗🤭🏠🤓🌝👩🏫🤭💤👩🏫👨❤️👨👩🏫👨❤️👨👍🏻👩🏫👍🏻👩🏫👍🏻👩🏫💔👨❤️👨🥺🥱🥱🥱🥱🥱🥱🥱🥱🥱🥱🥺🥺🥺🤐🤐🤐😓😓😓😓🤬😓🤬😓🤬🤬😓🤬🤬🤬😓🥱🥱🥺😔🤫🤬🤬🤬😭😭😭😭😭😭🥳😍🤩😏😌😌😌😌😌😌😏😏😴😪😪😪😪😪😪🥺🥺🥺🥺🥺🥺🥺😔🥳🥳😭🤣
🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓👽👽👽👽👽👽👽❤️❤️❤️😺😺😺💪🏻💪🏻💪🏻💪🏻✍️🤳🏿🙏🏻🤳🏿👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️💂💂💂💂👼👩✈️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️🕵️👩🏼🏫👮🏻♀️👮🏻♀️👨💻👮🏻♀️👨💻👮🏻♀️👮🏻♀️👨💻👮🏻♀️🧑👮🏻♀️🧑👮🏻♀️👮🏻♀️🧑👨⚖️👧🏼👩🎓🕵️👼🤺🤺👩⚕️🤺🤺👩⚕️🤺🤺🤺🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🛌🛌🛌🛌🛌🛌🧖🚶♂️
Jsovf jlntgek jojwgv sfjl jsvfonjowvjonwfwnvjfounvwofnuovwfnjowvffnuowvfnjonjoevfnjovefnjowfvnjovfwnjovwfnjovwfnjpwvfnjvwpfnjpvwfnjpvef vkpefvjenfpgefnjpnjowgfgnuwpfnjvoefnjogwfnjvowfnjoegfnjvowfnupwvfnjowvfnjpvefnjpvwfjnpwvfnjpwvfwvnfjpnjovwfnjovwfnuovefnjovwfnjogwfnugowfnjogwfnjovwfnojvwfvwnfojnjovwf jovwf jovwfbjovwfnojwvfnjowvfowjvnfjnowvfnjowvfunpwvfnipwvfnjpwvfnjpvefvjneofnejvfojpnevfnjpvefnjovwfnwjovvwfnjpvnjpwfjpnvefnjovwfnjpwvfnjowfvjoojevfnjovefnjpvefnjpnpjevfvefnjpnjpwvfvnwkfpnkpwvfnkpvwfnkpvefnpkvefnkvpefve kfpvefnkpveknpfvwfnkpvnjepfvknwpfvwfnkpvwfknpu0ncwrinpwfcnipwfcincpwfnkpwcfnkvwfpnpkvwf pkwvf kpwvfpnkvwfpknvfwknpvwfpnkkpnvwfnkpvwfnkpvwfnkpvwfnkpvwfnkvpwf kpvwfnkpvfwnkpvwfpvknwfnkpvwfnkpwvfvwfkpnnkpvwfnkpvwfnkvwpfkpnvwfnkpvfwnkpwvfpnkvwfvnkpwfvnwfpkvwfnpkvwfnkpjpnvwfnkpwvfvwknpfvwknpfvwfnpkvwfpnjpnjvwfpjnvwfnkpvwfpnjvfvwfnpjvwfpnjnpjvwfpnjvwfvwnjfponvjwfnojvwfvnwojfnojvwfojnvwfnjowvfnpjcwfpnjvwfpnjvwfnpjvwfpjnwvfojnvwvojnvwfjonvwfnojvwfjbofvefoubwvfuobwvfuon
👩🎓👩🎓👩🎓👩🎓👩🎓👩🎓👩🎓🚶♂️👩🎓🚶♂️👩🎓👩🎓👩🎓🚶♂️👩🎓🚶♂️👩🎓👩🎓🚶♂️👼🤺🏃👮🏻♀️👮🏻♀️👮🏻♀️👼👩✈️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🚶♂️🤓🚶♂️🤓🤓🚶♂️🤓🚶♂️🤓🚶♂️🤓🤓🚶♂️🤓🕵️👩⚕️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️😺😺😺😺😺👮🏻♀️👮🏻♀️👮🏻♀️😺😺😺😺😺😺😺👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️💂💂💂💂💂💂💂👩🎓🕵️👩⚕️👩⚕️👩⚕️👩⚕️👮🏻♀️
😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍😍🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩🤩👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️👮🏻♀️❤️❤️👮🏻♀️❤️❤️👮🏻♀️❤️👮🏻♀️❤️❤️👮🏻♀️❤️👮🏻♀️❤️❤️👮🏻♀️❤️🚶♂️🤓🤓🤓🤓🤓🤓🤓👨⚖️🤓👮🏻♀️🤓👨⚖️👮🏻♀️👨⚖️👮🏻♀️👨⚖️👨⚖️👮🏻♀️👨⚖️👨⚖️👮🏻♀️🤓👮🏻♀️🤓😺💂
This Video is so cute. I Love it ! 😍
2023 still watching the show
Yes
wow...that was beautiful!! brilliant job love all your videos! :D
omg this is the best thing ever!!!! omg im crying!!! thank you so much for this! i love it and i love you and the way u make these videos
This is awesome! I love it! I miss Castle so, so much. ❤️
Great Video!😊Caskett Forever!😘
I missing Caskett!😢
Best tv Series at all!😊So sweet!😍
It's super cute!! I miss them so bad!
This is so cute ❤
Merci beaucoup pour cette très belle vidéo
Omg this is amaizing 💗 i love it ... and muss them so much . Thanks for this
What a video I love one it is everything thank you so much
THE PERFECT SHOW
Wow Jo...you nailed it again! Nice one!!! Love it 😍 😍 😍 😍
Amazing!! Castle forever ❤️ thanks
wooooow. .... Amazing video, thank you!!!!
Yesss Caskett continues!
Now that was a perfect ending..
Great family 👏
beautiful
I LOVE IT! AMAZING
I miss them, thank you :3 ♡
Por favor, no me hagan esoooo, que bellezaaaaaa😭😭😭❤️❤️❤️❤️ waiting for something, anything please! CASKETT LOVERS ARE HERE!!! 2020 and still waiting🙏🏼
AAAHHH I LOVE IT
Best show ever 😊
I love this show
SERIES FAREWELL WAS SADDEST BUT BEST ENDING ❤❤❤❤❤
This was awesome I love it
omg jo this is amazing rlly😍❤
Wow beautiful and amazing
beautiful ❤❤❤
wow amazing video
Excellent..
this video is made really good. Thanks!
This is amazing
They are amazing 😍 the series is available on Disney+❤️
🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭🤭👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️❤️❤️😇❤️❤️❤️❤️🧖🏼♀️🚖😀😀😀🥰😍🥰🤩🌞🍜🌪️
Mdñ!sñldp!d
!d
!d
Wmp?q
🍜🍜🍜🍜🍜🍜🍜🍜🌞♥️😻✍️✍️✍️✍️✍️✍️✍️🤳🏿🤳🏿🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️🧖🏼♀️👌👌🧏🏻♂️🛌🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃🏃👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️👮🏻♀️
9irwgq k
Ldmñk2rngdkñdrwpk4guoapi14idkkni29o4gnnqpirakgnpieqn
Wjrofnipjv22gip4otpall
Fqqfl
Eoo
Qmqof
Fopmmfad
!qfl
Epe
Elf
Mfñelacl
Wlrgml
Argl
Gmkpmw4opgk
Ljwi4prmcl
Kw4optnckpw4ñk
O2o4untmeal
Cm2plrkem1
O3rkpwfm23
Lf
L24iptkfl
24tknq
L3rmpkr2jripp
Thankful for fan videos like these that are the epitome of my Caskett nerd level
thats a good imagination for this video!
The best ❤️
love it
Amazing 😍😍😍
What a cute video mmmmmmm ☺️☺️😘😘 you’re really good doing these!
Beckett I think that you did a wonderful job on finding your mother killer and castle is a wonderful job to help you and both of you did a fantastic job very happy for both of you and made my day good
2024 and still watching Caskett vids. Love this. Will ALWAYS love them. #Always
Nathan Fillion und Stana Katic sind einfach unumstritten ein Traumpaar. Würden sie im wirklichen Leben heiraten, kämen bei so wunderschönen sexy Eltern nur bildschöne Babys raus. Diese beiden sind füreinander bestimmt
Stimmt😍
Nur haben sie sich in echt angeblich nicht so gut verstanden🤷♀️,aber das weiß niemand so genau
Das stimmt
Ich wünsche euch nur das Beste im Leben Beckett und Castle 🇩🇪❤️🇺🇲
🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝🌝❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓💏💏💏💏💏👁️👁️👁️👁️👁️👁️👁️🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰🥰❤️❤️❤️❤️❤️❤️🏙️👩✈️🤓🤓🤓🤓😘🥱🤓🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🤫🏠🤫🤫🤫🏙️👩✈️🥰😅😌😌❤️🚔
J od v pevgv ejo3fnvkkvm3tkgjefkvk3tvtkvmkoemfkkkp kpmkpcmi krognkvmekgmkpvmkoenfvko kpegvv k efvk kegk kodfs vke gk efvk klef vkl ekovke ko. Eekbg f. Ker kgob kor k. Kpr bkp krgp bbkdgmekbbmmegkmekpengbnkoegbnkknpekgbnokenkdbfoemoefb k egñnbñ egñ kpe fvjeovoevnfpneekogvnnvk efkvenvkoe evkmkepfvnvkpvmegpi0ibemkbndmeigvmdkoegv vcckp egkpv koegvkvnkeogvnckbenkovnipegkiepgvkmeovmviemfvpmkevnnpnfnekogfneviepnvi9nekkdovvdvpfmvinveekvnekoeenjfvonkoefvnneufvouvnegvjsvsnuoefnvjevfvuonnvievnknefokwvnok3fokefvonnveffnkvn3jfonkoevfknkvefj efjvoncevrnkokjoeffnkpnefvofnuov3rfnwvjnevvfkonjoervnwvfjnefvjonuiefvnvwuofnerjvfjnefjvoioefvivnjofvkenfvvknuoefvnkefnvenefvionkpefvknefkvonkeofvkenfvonkoefvkp3fvnkoefvkpminevfkvnkneknjonevfnjeovfkevnfoefvjnvefnkoefvkjokovnveeevnejvfnnvjoeffnvkoenffkowfkvovnjvoelvfnkovefnknevkveonvjeofnjeofvnkoefvjoenvjenvfjvjefvkevfjoeevfjvenfknefvnjoenkoevfkovnevkfojoevfnjoefvkenfvfjevfjonefvjojoefvjoenvfjefnvfjevnfjenfvjjenfvonejfvnkoefnfkekkoeffevkekflvnjlefvnjlnefvlnejofvnjlefvfnkeenfjvefnkeeneefvklkoefvnkefnvknevfkononokenfvñke
👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️🏠🏠🏠🏠🏠🏠🌇🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🏠🌞🌞🌞🌞🌞🌞🌞🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️🏙️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️👩✈️❤️❤️❤️❤️❤️❤️🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓🤓❤️❤️❤️😁🌇🌇🌝👩✈️💏🏠🤫
So cute 😁
That is wonderful news that you and castle are going to have a baby
OH MY FUCKING GOD I ABSOLUTELY LOVE THIS OML I CAN'T EVEN GET OVER THIS OML OML OML
Me encantó este vídeo y la música
Pero si quisiera saber el nombre de la canción ,se los agradecería 💯❤️
Meraviglioso 😍 (wanderfoll)...
Miss them so much❤️❤️❤️
WOW❤️❤️❤️
Wow ❤️
This made me cry. Why, oh why they didn't give us pregnant Beckett! :'(
What episode is at 1:07 when they are going through the kitchen with guns drawn?
Kate you like just like your mom you both are very beautiful woman
Beckett you and castle would make a wonderful part for your family
It’s 2021 and I’m wishing for a reboot it’s sad we didn’t get to see Beckett pregnant I feel like they would baby wear their baby at the crime scenes while on maturity leave to still work on the cases
I feel like Lily would be a mini castle while the twins would be mini Becketts
2024 still watching. I am on a marathon 😊😊😊
2023 and I'm still watching ❤️❤️
Oh my God I'm crying 😭😭😭😍😍
What episode is 1:08, please.
Caskett forever❤️❤️☺️always.
Reminds me of good days 😭
Super castle parfait couplé comme policier