EVERYTHING Size Comparison 2021 (FULL) 3D 4K 60FPS
ฝัง
- เผยแพร่เมื่อ 5 ต.ค. 2024
- Hi everyone!
This is the completed version of the Everything Size Comparison 2021! Parts 1-11 combined into one video. It contains absolutely everything in the universe beginning from the smallest things like protoverse, subatomic particles like preons, quarks, electrons, protons, neutrons, atomic nuclei, all atoms, molecules, biological structures, wavelengths, grains of sand and salt, human scale objects, tanks (both from WWII and modern), missiles, different species of trees, asteroids, moons, mountains, pulsars, large moons, solar system planets, exoplanets, rocky planets, gas giants, brown dwarfs, small stars like red dwarfs, bigger stars like our Sun, big stars like Rigel, Pistol star etc, red giants, supergiants and hypergiants like Aldebaran, Betelgeuse, Antares, VY Canis Majoris, UY Scuti, Stepherson 2-18, quasi star, planetary and star systems, debris disks, black holes, blasars, quasars, then things larger than light year - nebulae, stellar clusters, galaxies, milky way, galactic groups, clusters and superclusters, the largest structures in the observable universe, the observable universe itself, and theoretical items that are larger than the observable universe - universe, larger universe, imaginary tetrahedron, dodecahedron, hexahedron, icosidodecahedron, larger universe, Mandelbrot zoom, various verses - Yoctoverse, Multiverse, Metaverse, Megaverse, Gigaverse, Teraverse, Exaverse, Tettaverse, Xenoverse, Hyperverse, Omniverse, the outside, barrel, the Box and finally infinity and transinfinity.
This video has fixed some errors
Don't forget to leave a like if you enjoyed, write a comment and subscribe to not miss any new videos!
Made with Blender 2.91.0 (Eevee), edited in Adobe After Effects
Music by Machinimasound licensed under Creative Commons Attribution 4.0
Music:
12:22 - Portal Mysterious Space Background Music No Copyright
16:07 - Great Plans Come Together - Sawsonic
33:53 - Kevin MacLeod - Interloper
44:08 - Trick or Treat (instrumental) - RYYZN (No Copyright Music)
59:52 - Bensound - Evolution
1:02:36 - Bensound - Epic
1:16:46 - Kevin MacLeod - The Complex
1:21:08 - • Universe UA - Infinity...
1:30:37 - The Game is On (Epic Movie_TV Intro Music) - Ross Bugden (No Copyright Music)
1:34:53 - Warrior Strife - Jingle Punks
1:38:59 - • Universe UA - Infinity...
1:51:16 - Stephen Barton - War Pig
1:52:57 - Max Brhon - Pain [NCS Release]
1:53:43 - Kevin MacLeod - Five Armies
1:56:18 - Warrior Strife - Jingle Punks
Chapters:
Part 1: 0:12
Part 2: 11:20
Part 3: 24:03
Part 4: 33:43
Part 5: 43:26
Part 6: 59:50
Part 7: 1:19:50
Part 8: 1:31:17
Part 9: 1:43:56
Part 10: 2:01:14
Part 11: 2:12:29
Watch other parts of the Size Comparison 2021!
Part 1 • EVERYTHING Size Compar...
Part 2 • EVERYTHING Size Compar...
Part 3 • EVERYTHING Size Compar...
Part 4 • EVERYTHING Size Compar...
Part 5 • EVERYTHING Size Compar...
Part 6 • EVERYTHING Size Compar...
Part 7 • EVERYTHING Size Compar...
Part 8 • EVERYTHING Size Compar...
Part 9 • EVERYTHING Size Compar...
Part 10 • EVERYTHING Size Compar...
Part 11 • EVERYTHING Size Compar...
Full version • EVERYTHING Size Compar...
#3d #4k #60fps #sizecomparison #comparison #4k60fps #cgi #render #blender #blendereevee #blendercycles #blenderartist #blenderartists #blenderart #blender3d #blender3dart #3dart #3dartist #cgiart #3drender #art #star #3dmodeling #blend3d #animation #animation3d #3danimation #3dart #3dartist #digitalart
0:00 smallest stuff
6:16 quarks
9:17 nucleuses
12:00 atoms
32:58 molecules
35:06 micro world
44:17 everyday objects
48:18 tanks
53:43 trees and buildings
59:57 mountains,asteroids and moons
1:15:38 planets
1:33:49 stars
2:10:09 systems,black holes and nebulas
2:19:04 galaxy’s and clusters
2:28:00 beyond the universe
Noice
When I click onto one of those Timestamps, i get bombarded with ads
Hhhhhhhhhhhhhh7
Kik@@extra...
Awesome. I even love the fact that you don't go into all those verbal explanations that can sometimes be boring with unnecessary stories. You just provide facts and let the audience read and watch the size comparison. From an INFJ in Nairobi.... THANK YOU!!!
Things I Spotted!
9:00 HIDDEN MICKEY
10:28 THERES TWO!??! BFDI x II animation
10:45 “and where’s the Venus nucleus?”
11:43 it’s a bird! It’s a plane! ITS SUPERMAN *1940s Superman music plays*
12:00 Ring around the Rosie’s! A pocket full of posies! Achoo! Achoo! We all fall down!
12:24 Wasp-12 B be like:
13:07 *insert goofy ahh gulping noises*
14:15 that I will lose if I hear one more BenjixScarlett song.
15:00 I never remembered mercury having moons.
15:13 “TENNESIUM, OGANESSON. AND. THEN. WE’RE. DOOOOONNNEEE.” - ASAP Science
16:14 Yukon, Alaska, California, Here I come!😊
19:54 “GOODBYE NAPOLEON”👺 - dumbledore said calmly
22:27 “where is the Teslinium atom?”
23:15 “ERM, ACTUALLY *sniff* THATS THE NICKEL ATOM” - 🤓
32:12 “….where is the Octavium atom?”
32:43 *see **13:07*
34:25 t h e d r o p p e r
36:03 “You are the few, the proud, you are the antibody, mind, soul, and zen.” - Smash Mouth
End of part 1…….. part 2 at 100 likes.
EVERYTHING Size Comparison 2021 (FULL) 3D 4K 60FPS
Timelapse:
0:00 Smallest Stuff
6:16 Quarks
9:17 Nucleuses
12:00 Atoms
32:58 Molecules
35:06 Micro World
44:17 Everyday Objects
48:18 Tanks
53:43 Trees And Buildings
59:57 Mountains, Asteroids And Moons
1:15:38 Planets
1:33:49 Stars
2:10:09 Systems, Black Holes And Nebulas
2:19:04 Galaxy’s And Clusters
2:28:00 Beyond The Universe
All Parts:
Part 1: 0:12
Part 2: 11:20
Part 3: 24:03
Part 4: 33:43
Part 5: 43:26
Part 6: 59:50
Part 7: 1:19:50
Part 8: 1:31:17
Part 9: 1:43:56
Part 10: 2:01:14
Part 11: 2:12:29
Watch other parts of the Size Comparison 2021!
Part 1: th-cam.com/video/z3n8Uu7SZBQ/w-d-xo.html
Part 2: th-cam.com/video/-0zSjPvnJxo/w-d-xo.html
Part 3: th-cam.com/video/CCR0oCzcUsk/w-d-xo.html
Part 4: th-cam.com/video/iseqSSbHYDk/w-d-xo.html
Part 5: th-cam.com/video/iohQpKXSIxI/w-d-xo.html
Part 6: th-cam.com/video/dk6GWmfGniw/w-d-xo.html
Part 7: th-cam.com/video/pFvCZeo-oUE/w-d-xo.html
Part 8: th-cam.com/video/TsVc4LtmiO8/w-d-xo.html
Part 9: th-cam.com/video/7lZdx-ukRjY/w-d-xo.html
Part 10: th-cam.com/video/V7HQ-KwdOj0/w-d-xo.html
Part 11: th-cam.com/video/qA1gFXSARh8/w-d-xo.html
Full version: th-cam.com/video/1ZFNmSyqNdk/w-d-xo.htmlsi=otWUkuFvxYPN_R4q
Absolutely fascinating, I've been waiting for it sooooo long!!! Great Ta!!!
Fact: there is a Possible Tool. Planck length to penny. It needs like 90000 universes In a 2d world. I do not like to Caculate THE MUCH
2:28:07 the observable universe
2:28:09 The universe
2:28:16 The Imaginary tetrahedron
2:28:22 The Imaginary dodecahedron
2:28:29 The Imaginary Hexahedron
2:28:36 The Imaginary Icosidodecahedron
2:28:44 The larger universe
2:28:51 The mandelbrot zoom
2:28:57 The Yoctoverse
2:29:05 The multiverse
2:29:12 The metaverse
2:29:19 the megaverse
2:29:26 The gigaverse
2:29:33 the Teraverse
2:29:40 The exaverse
2:29:47 The L-Verse
2:29:53 The Xenoverse
2:30:01 The Hyperverse
2:30:08 the Omniverse
2:30:15 The outside
2:30:22 The barrel
2:30:29 The box
2:30:36 The infinity
2:30:43 The Transinfinity
2:28:26 Imaginary Dodecahedron is not Imaginary Icosidodecahedron and 2:28:37 Imaginary Icosidodecahedron is not Imaginary Dodecahedron
2:10:11 Vega System
2:10:20 Sirius System
2:10:39 M60 Black Hole
2:10:57 Holmblerg 15A B/H
2:11:15 Beta Pictoris System
2:11:31 S5 0014+81
2:11:49 TON 618
2:12:17 1 Light Year
2:12:35 The Oort Cloud
2:12:51 The Helix Nebula
2:13:08 The Pillars Of Creation
2:13:27 The Flame Nebula
2:13:33 Pleiades Cluster
2:14:00 Beehive Cluster
2:14:19 Cave Nebula
2:14:34 Veil Nebula
2:14:54 47 Tucaenae
2:15:12 M60 UCD1
2:15:28 Messier 3
2:15:45 Omega Centauri
2:16:03 Palomar 12
2:16:20 RCW 49
2:16:37 Carina Nebula
2:16:56 Small Sagittarius Star Cloud
2:17:14 30 Dorarus
2:17:35 Gum Nebula
2:17:48 Circinus Galaxy
2:18:05 Gould Belt
2:18:25 Small Magellanic Cloud
2:18:40 Large Magellanic Cloud
2:18:59 Sombrero Galaxy
2:19:21 Triangulum Galaxy
2:19:33 Whirpool Galaxy
2:19:57 Hoag's Object
2:20:12 Cartwheel
2:20:27 Milky Way
2:20:42 Pinwheel Galaxy
2:21:00 Andromeda Galaxy
2:21:22 Tadpole Galaxy
2:21:35 Condor Galaxy
2:21:58 Malin 1
2:22:11 Caldwell 35
2:22:34 NGC 4921
2:22:45 IC1101
2:23:05 Abell 2029
2:23:20 Local Group
2:23:44 Hydra Cluster
2:24:03 Centarus Cluster
2:24:15 Virgo Cluster
2:24:30 SCL@1338+2
2:24:48 Phoenix Cluster
2:25:06 Virgo Supercluster
2:25:31 Hercules Supercluster
2:25:47 Hydra Centarus Supercluster
2:26:00 Ursa Major Supercluster
2:26:22 Great Attractor
2:26:32 Laniakea
2:26:57 Pisces Cetus Supercluster Complex
2:27:12 Sloan Great wall
2:27:27 Huge LQG
2:27:43 Hercules Corona Borealis
2:28:07 Observable universe
2:28:10 Universe
2:28:16 Imaginary tetrahedron
2:28:22 Imaginary dodecahedron
2:28:29 Imaginary Hexahedron
2:28:37 Imaginary Icosidodecahedron
2:28:44 larger universe
2:28:51 Mandelbrot Zoom
2:29:03 Yoctoverse
2:29:04 Multiverse
2:29:12 metaverse
2:29:19 megaverse
2:29:26 Gigaverse
2:29:33 Teraverse
2:29:43 Exaverse
2:29:48 L Verse
2:29:54 Xenoverse
2:30:02 Hyperverse
2:30:09 Omniverse
2:30:15 The Outside
2:30:21 Barrel
2:30:29 The box
2:30:36 Infinity
2:30:43 Transfinity
2:30:49 Outro
WHAT
How does this dude only have 14.4K Subscribers? He’s made videos for 5 years! Like, how come he has 14.4K? This dude deserves more, Especially because he made a 2 hour 30 minute video, in less than 1 year! This is amazing, he made 13 parts into this, and those parts took less than a year, I’m impressed by how fast he made this, I wish you go far Universe UA.
Also, here are the atoms in order.
1. Hydrogen: 12:21
2. Helium: 13:31
3. Lithium: 18:53
4. Beryllium: 21:00
5. Boron: 18:11
6. Carbon: 16:47
7. Nitrogen: 14:41
8. Oxygen: 14:13
9. Fluorine: 13:59
10. Neon: 14:27
11. Sodium: 28:16
12. Magnesium: 17:01
13. Aluminum: 19:36
14. Silicon: 12:07
15. Phosphorus: 21:28
16. Sulfur: 11:53
17. Chlorine: 17:29
18. Argon: 20:46
19. Potassium: 31:07
20. Calcium: 29:19
21. Scandium: 28:47
22. Titanium: 26:12
23. Vanadium: 24:54
25. Manganese: 25:10
26. Iron: 12:35
27. Cobalt: 23:48
28. Nickel: 23:06
29. Copper: 13:48
30. Zinc: 13:17
31. Gallium: 20:32
32. Germanium: 25:41
33. Arsenic: 19:50
34. Selenium: 21:14
35. Bromine: 20:04
36. Krypton: 24:08
37. Rubidium: 31:39
40. Zirconium: 20:18
41. Niobium: 25:57
42. Molybdenum: 21:42
43. Technetium: 19:07
44. Ruthenium: 17:57
45. Rhodium: 17:15
46. Palladium: 16:33
47. Silver: 16:19
48. Cadmium: 15:23
49. Indium: 27:14
50. Tin: 28:01
51. Antimony: 25:25
53. Iodine: 30:21
54. Xenon: 26:27
55. Caesium: 32:10
56: Barium: 30:52
58. Cerium: 30:36
59. Praseodymium: 30:05
60. Neodymium: 28:32
61. Promethium: 29:50
72. Hafnium: 27:45
73. Tantalum: 26:59
75. Rhenium: 24:39
76. Osmium: 23:20
77. Iridium: 18:25
78. Platinum: 17:43
79. Gold: 16:05
80. Mercury: 14:55
81. Thallium: 27:30
82. Lead: 24:23
83. Bismuth: 29:03
86. Radon: 21:56
87. Francium: 32:25
88. Radium: 31:23
90. Thorium: 29:34
92. Uranium: 31:54
93. Neptunium: 23:34
94. Plutonium: 22:38
98. Californium: 22:52
99. Einsteinium: 22:24
100. Fermium: 22:10
112. Copernicium: 26:43
113. Nihonium/Ununtrium: 18:39
114. Flerovium/Ununquadium: 15:37
116. Livermorium/Ununhexium: 19:22
117. Tennesine/Ununseptium: 15:51
118. Oganesson/Ununoctium: 15:18
Also, here’s a pulsar part. 1:05:27.
Thanks. Really is often disappointing
and instead if showing good youtubers like this youtube rather shows sniperwolf and co
Bro You have So much replies
@@UniverseUA
Do you remember the title of the soundtrack that begins at 26:45?
@@UniverseUA😊
0:19 protoverse
0:37 planck length
1:02 tau neutrino
1:16 title string
1:57 anti-neutron
2:15 x-boson
0:10 Part 1
11:21 Part 2
24:03 Part 3
33:42 Part 4
43:26 Part 5
59:49 Part 6
1:19:50 Part 7
1:31:18 Part 8
1:43:56 Part 9
2:01:14 Part 10
2:12:29 Part 11
44:21 music - music is made marble mania
153:23:44
5622517726262564145435667617655378163534628735341763413642284867355422882873863763652542787847746763635543553553653667363878373877366353653653553553656367367367366553453443243143424525625636736837837763753653545344234329999887878789789789898899809909900990909898789877877876877676776765765665555556576667677667778778:12:33 PART 24.912TRGMUC
shyystsfstffstrwtrfwtfsftfaftrafrqdrqddsctfsvftstsarddrad
58:35 OUMUAMUA IS LEFT
This is the largest universe size comparison I have ever seen nice job on it so large it is wonderful and ginormous it is the best one ever so long I love it so much it is perfect it’s the longest I have ever seen
0:00:17 Protoverse
0:00:34 Planck Length
0:00:46 Graviton
0:01:02 Tau Neutrino
0:01:16 String
0:01:30 Brane
0:01:44 Anti-proton
0:01:57 Anti-neutron
0:02:12 X-boson
0:02:26 Muon Neutrino
0:02:41 Y-boson
0:02:53 Electron Neutrino
0:03:03 Fermion
0:03:23 Tachyon
0:03:36 Calabi Yau Manifold
0:03:50 Quantum Foam
0:04:04 Muon
0:04:19 Planck Particle
0:04:33 Yoctometer
0:04:46 1 MeV Neutrino
0:05:04 Top Quark
0:05:18 Preon
0:05:32 Zeptometer
0:05:46 High Energy Neutrino
0:06:09 Bottom Quark
0:06:22 Charm Quark
0:06:36 Strange Quark
0:06:50 Attometer
0:07:04 Up Quark
0:07:18 Down Quark
0:07:32 Electron
0:07:46 Weak Force
0:08:04 Femtometer
0:08:18 Neutron
0:08:32 Proton
0:08:45 Hydrogen Nucleus
0:09:00 Tritinium Nucleus
0:09:14 Helium Nucleus
0:09:28 Lithium Nucleus
0:09:42 Oxygen Nucleus
0:09:56 Neon Nucleus
0:10:10 Chlorine Nucleus
0:10:24 Nickel Nucleus
0:10:38 Mercury Nucleus
0:10:52 Uranium Nucleus
0:11:06 Ununoctium Nucleus
0:11:25 Picometer
0:11:39 X-ray Wavelength
0:11:53 Sulfur Atom
0:12:07 Silicon Atom
0:12:21 Hydrogen Atom
0:12:38 Iron Atom
0:12:49 Ammonia Molecule
0:13:03 Water Molecule
0:13:17 Zinc Atom
0:13:31 Helium Atom
0:13:45 Copper Atom
0:13:59 Fluorine Atom
0:14:13 Oxygen Atom
0:14:27 Neon Atom
0:14:41 Nitrogen Atom
0:14:54 Mercury Atom
0:15:09 Oganesson Atom
0:15:23 Cadmium Atom
0:15:37 Flerovium Atom
0:15:51 Tennesine Atom
0:16:06 Gold Atom
0:16:19 Silver Atom
0:16:33 Palladium Atom
0:16:47 Carbon Atom
0:17:01 Magnesium Atom
0:17:15 Rhodium Atom
0:17:29 Chlorine Atom
0:17:43 Platinum Atom
0:17:57 Ruthenium Atom
0:18:11 Boron Atom
0:18:25 Iridium Atom
0:18:39 Nihonium Atom
0:18:53 Lithium Atom
0:19:07 Technetium Atom
0:19:21 Livermonium Atom
0:19:36 Aluminium Atom
0:19:49 Arsenic Atom
0:20:04 Bromine Atom
0:20:18 Zirconium Atom
0:20:31 Gallium Atom
0:20:46 Argon Atom
0:21:00 Beryllium Atom
0:21:14 Selenium Atom
0:21:28 Phosphorus Atom
0:21:42 Molybdenum Atom
0:21:56 Radon Atom
0:22:09 Fermium Atom
0:22:24 Einsteinium Atom
0:22:38 Plutonium Atom
0:22:52 Californium Atom
0:23:07 Nickel Atom
0:23:20 Osmium Atom
0:23:34 Neptunium Atom
0:23:49 Cobalt Atom
0:24:08 Krypton Atom
0:24:23 Lead Atom
0:24:39 Rhenium Atom
0:24:54 Vanadium Atom
0:25:10 Manganese Atom
0:25:26 Antimony Atom
0:25:41 Germanium atom
0:25:57 Niobium Atom
0:26:12 Titanium Atom
0:26:28 Xenon Atom
0:26:43 Copernicium Atom
0:26:59 Tantalum Atom
0:27:15 Indium Atom
0:27:30 Thallium Atom
0:27:46 Hafnium Atom
0:28:01 Tin Atom
0:28:16 Sodium Atom
0:28:32 Neodymium Atom
0:28:48 Scandium Atom
0:29:03 Bismuth Atom
0:29:18 Calcium Atom
0:29:34 Thorium Atom
0:29:50 Promethium Atom
0:30:06 Praseodymium Atom
0:30:21 Iodine Atom
0:30:37 Cerium Atom
0:30:52 Barium Atom
0:31:08 Potassium Atom
0:31:23 Radium Atom
0:31:39 Rubidium Atom
0:31:55 Uranium Atom
0:32:10 Caesium Atom
0:32:26 Francium Atom
0:32:41 Alcohol Molecule
0:32:57 Ethanol Molecule
0:33:12 Adenine Molecule
0:33:28 Nanometer
0:33:48 Buckyball Molecule
0:34:06 Adenosine Molecule
0:34:23 Carbon Molecule
0:34:41 Glucose Molecule
0:34:58 DNA String
0:35:16 Phospholipid Bilayer
0:35:33 Hemoglobin
0:35:51 Antibody
0:36:08 Bacteriophage
0:36:25 Ultraviolet Light W/L
0:36:43 Violet Light Wavelength
0:37:01 Purple Light Wavelength
0:37:17 Blue Light Wavelength
0:37:36 Cyan Light Wavelength
0:37:52 Green Light Wavelength
0:38:10 Yellow Light Wavelength
0:38:28 Orange Light W/L
0:38:45 Red Light Wavelength
0:39:04 Infrared Light W/L
0:39:21 Micrometer
0:39:38 Lysosome
0:39:56 Y Chromosome
0:40:13 E. Coli
0:40:31 X Chromosome
0:40:48 Red Blood Cell
0:41:06 Chloroplast
0:41:23 White Blood Cell
0:41:41 Pollen
0:41:58 Thiomargarita Namibiensis
0:42:16 Amoeba
0:42:34 Grain Of Salt
0:42:51 Grain Of Sand
0:43:08 Millimeter
0:43:32 Snow Crystal
0:43:49 Centimeter
0:44:07 Coffee Bean
0:44:24 Tennis Ball
0:44:42 Fox Terrier
0:45:03 Meter
0:45:16 AGM-114 HellFire
0:45:35 Human
0:45:52 AGM-65
0:46:09 R73
0:46:27 AIM-120D
0:46:44 MBDA Meteor
0:47:02 Japanese Spider Crab
0:47:20 Apple Tree
0:47:35 R27
0:47:54 SM-2
0:48:12 Pz. II
0:48:30 Pz. III
0:48:47 Common Box
0:49:04 BGM-109 Tomahawk
0:49:22 M4
0:49:39 Pz. IV
0:49:57 T-34
0:50:14 T-34-85
0:50:31 Su-85
0:50:49 Su-100
0:51:07 Tiger I
0:51:25 T-62
0:51:42 KV-1
0:51:59 KV-2
0:52:16 IS-3
0:52:34 Panther I
0:52:52 Tiger II
0:53:10 Leopard 2A6
0:53:27 M1 Abrams
0:53:45 Dragon Tree
0:54:02 Salix Babylonica
0:54:19 Stone Pine
0:54:36 Ash Tree
0:54:55 Palm Tree
0:55:21 Baobab
0:55:29 Blue Whale
0:55:47 Sycamore
0:56:04 P. 1000 Ratte
0:56:22 Conker Tree
0:56:39 Oak
0:56:57 Brazil Nut Tree
0:57:15 Eucalyptus
0:57:32 Fir Tree Noble
0:57:50 ISS
0:58:07 Hyperion Sequoia
0:58:25 Oumuamua
0:58:42 Titanic
0:59:02 Burj Khalifa
0:59:19 Angel Falls
0:59:37 Kilometer
0:59:56 Mt. Meron
1:00:13 Aegaeon
1:00:31 Methone
1:00:48 PSR B0943+10
1:01:06 Mt. Kilimanjaro
1:01:23 Mt. Everest
1:01:41 Maxwell Montes
1:01:59 Mariana Trench
1:02:16 Deimos
1:02:34 Halley's Comet
1:02:51 PSR J0348+043
1:03:09 Lich Pulsar
1:03:26 Crab Pulsar
1:03:44 Olympus Mons
1:04:01 Phobos
1:04:18 PSR B1919+21
1:04:36 PSR J0437-4715
1:04:53 PSR B1957+20
1:05:11 PSR J1719-1438
1:05:28 PSR J2144-3933
1:05:46 PSR B1937+21
1:06:03 Pan
1:06:20 PSR J1311-3430
1:06:39 PSR J1748-2446AD
1:06:56 Eros
1:07:14 XTE JI650-500
1:07:31 Cygnus X-1
1:07:49 Epimethus
1:08:06 Chiron
1:08:24 Hyperion
1:08:41 Nix
1:08:58 Chariklo
1:09:16 Hi‘iaka
1:09:33 Mimas
1:09:51 Enceladus
1:10:08 Vesta
1:10:26 Ixion
1:10:43 Dysnomia
1:11:01 Quaoar
1:11:18 Ceres
1:11:36 Umbriel
1:11:54 Dione
1:12:11 Ariel
1:12:28 Charon
1:12:46 Iapetus
1:13:03 Makemake
1:13:21 Oberon
1:13:38 Titania
1:13:56 Haumea
1:14:13 Eris
1:14:31 Pluto
1:14:49 Triton
1:15:06 Europa
1:15:23 The Moon
1:15:41 Io
1:15:59 Kepler-37b
1:16:16 Kepler-444b
1:16:34 Callisto
1:16:51 Mercury
1:17:09 Titan
1:17:26 Ganymede
1:17:44 Kepler-444c
1:18:01 Kepler-62c
1:18:18 Kepler-444d
1:18:36 Mars
1:18:53 A.C.+70*8247
1:19:11 IK Pegasi B
1:19:29 Trappist-1h
1:19:56 Sirius B
1:20:14 TRAPPIST-1e
1:20:31 Venus
1:20:49 The Earth
1:21:06 TRAPPIST-1f
1:21:24 TRAPPIST-1c
1:21:41 TRAPPIST-1b
1:22:00 Proxima B
1:22:16 Trappist-1g
1:22:34 HLX-1
1:22:52 Van Maanen's Star
1:23:10 Kepler-62f
1:23:26 Kapteyn B
1:23:44 Kepler-10b
1:24:01 Kepler-366b
1:24:18 40 Eridani B
1:24:36 Gliese-667Cc
1:24:54 COROT-7b
1:25:11 Gliese-876d
1:25:29 Kepler-62e
1:25:46 Kepler-69c
1:26:04 Gliese-667Cf
1:26:21 Gliese-667Ce
1:26:39 KOI-1781b
1:26:57 WASP-47c
1:27:13 Wolf 503b
1:27:31 Kepler-22b
1:27:49 Gliese-667Cg
1:28:07 Procyon B
1:28:24 Epsilon Eridani B
1:28:49 Planet Nine
1:28:59 Neptune
1:29:16 Kepler-1625b b
1:29:34 Uranus
1:29:51 Gliese-667Cd
1:30:09 Gliese-667Cb
1:30:27 Kepler-669b
1:30:44 Epsilon Eridani c
1:31:01 Kepler-51b
1:31:23 Pollux b
1:31:41 Kepler-16b
1:31:59 Teide 1
1:32:16 Epsilon Indi BA
1:32:33 SWEEPS-04
1:32:51 Saturn
1:33:08 EBLM J0555-57AB
1:33:25 Jupiter
1:33:43 DX Cancri
1:34:01 SIMP J013656.5+0933473
1:34:18 47 Ursau Majoris b
1:34:35 OGLE-TR-122b
1:34:53 TRAPPIST-1
1:35:11 Fomalhaut b
1:35:28 Teegarden's Star
1:35:46 TRES-2b
1:36:04 Luyten 726-8 A
1:36:21 Proxima Centauri
1:36:38 51 Pegasi b
1:36:56 Beta Pictoris B
1:37:14 Ross 248
1:37:31 YZ Ceti
1:37:49 Wolf 424 A
1:38:06 WASP-17b
1:38:23 Groombridge 34 B
1:38:41 Barnard's Star
1:38:59 HAT-P-32b
1:39:16 Upsilon Andromedae B
1:39:34 CT Chamaeleontis
1:39:51 Ross 154
1:40:09 Gliese 1
1:40:26 Kruger 60 B
1:40:44 Kapteyn's Star
1:41:01 40 Eridani C
1:41:19 Luyten's Star
1:41:36 Kruger 60 A
1:41:53 Gliese-876d
1:42:11 Groombridge 34 A
1:42:28 Lalande 21185
1:42:46 Gliese-667 C
1:43:03 AT Microscopii A
1:43:21 HD 100546 B
1:43:39 Gliese-667 B
1:44:01 Epsilon Indi A
1:44:18 Kepler-70 System
1:44:36 Epsilon Eridani
1:44:53 Alpha Centauri B
1:45:11 The Sun
1:45:29 WASP-47
1:45:46 Alpha Centauri A
1:46:04 Sirius A
1:46:21 IK Pegasi A36
1:46:39 Kepler-36
1:46:56 Altair
1:47:14 Kepler-42 System
1:47:31 Algol Ab
1:47:48 Fomalhaut
1:48:06 Procyon
1:48:24 Beta Piscis Austrini A
1:48:41 Epsilon Boötes B
1:48:59 Algol Aa1
1:49:16 Vega
1:49:33 Algol Aa2
1:49:51 Regulus
1:50:09 Bellatrix
1:50:26 V404 Cygni B
1:50:43 Beta Lyrae Aa2
1:51:01 Gamma Velorum WR
1:51:19 Pollux
1:51:36 VV Cephei B
1:51:53 COROT-7 System
1:52:11 Kepler-444 System
1:52:29 Omicron Persei Ab
1:52:46 Omicron Persei Aa
1:53:03 Achernar
1:53:21 Kepler-49 System
1:53:38 Kepler-19 System
1:53:56 Kepler-36 System
1:54:14 Kepler-32 System
1:54:31 Kepler-223 System
1:54:48 Beta Lyrae Aa1
1:55:06 Gamma Velorum O
1:55:23 Zetta Puppis
1:55:41 Kepler-9 System
1:55:59 Arcturus
1:56:16 Kepler-10 System
1:56:33 Kepler-37 System
1:56:51 Kepler-33 System
1:57:08 R136A1
1:57:26 Saggitarius A*
1:57:44 Epsilon Boötes A
1:58:01 Kepler-436 System
1:58:19 Polaris
1:58:36 Kepler-20 System
1:58:54 Kepler-186 System
1:59:11 Kepler-62 System
1:59:28 Aldebaran
1:59:46 Kepler-11 System
2:00:03 Gliese-667 System
2:00:21 Kepler-69 System
2:00:38 Alpha-Percei
2:00:56 Canopus
2:01:19 Kepler-16 System
2:01:38 Rigel
2:01:55 Gamma Andromedae A
2:02:12 VFTS 102
2:02:29 Gacrux
2:02:47 WASP-47 System
2:03:05 Deneb
2:03:22 S Doradus
2:03:39 Pi Puppis
2:03:57 Pistol Star
2:04:14 Gliese-892 System
2:04:32 La Superba
2:04:49 IRC+10420
2:05:07 R Doradus
2:05:24 Eta Carinae A
2:05:41 Gliese-581 System
2:06:00 VV Cephei A
2:06:17 119 Tauri
2:06:34 55 Cancri System
2:06:52 Antares
2:07:09 Mu Cephei
2:07:27 Betelgeuse
2:07:45 HR 5171
2:08:02 VY Canis Majoris
2:08:20 UY Scuti
2:08:37 Stephenson 2-18
2:08:55 Fomalhaut System
2:09:11 Outer Solar System
2:09:29 Kuiper Belt
2:09:47 Quasi Star
2:10:04 Vega System
2:10:22 Sirius System
2:10:39 Messier 60
2:10:57 Holmberg 15A B/H
2:11:14 Beta Pictoris System
2:11:32 S5 0014+81
2:11:50 TON 618
2:12:12 Light Year
2:12:34 Oort Cloud
2:12:52 Helix Nebula
2:13:09 Pillars Of Creation
2:13:27 Flame Nebula
2:13:44 Pleiades Cluster
2:14:02 Beehive Cluster
2:14:20 Cave Nebula
2:14:37 Veil Nebula
2:14:54 47 Tucanae
2:15:12 M60-UCD1
2:15:30 Messier 3
2:15:47 Omega Centauri
2:16:04 Palomar 12
2:16:22 RCW 49
2:16:39 Carina Nebula
2:16:57 Small Saggitarius Star Cloud
MAXIMUM LETTERS
Wow. That took you a very long time to do all of that!
Gould Belt
How just how
UY Scuti
Stephenson 2-18
wow thats excelent job, could you teach me to do that? i could pay you! or at least tell me which programs you used
Don’t forget about editing with adobe after effects!
Great and entertaining size comparison video, overall!
Also, looking for the title of the soundtrack for years-- 1:51:19 . hope someone may know what the soundtrack is called. Thanks.
Glad you like it!
The music is called Stephen Barton - War Pig
@@UniverseUA Thank you so much!
You mom will happy
And
Universe UA u can make videos for u a blender physics bigolagy new movies or nice movies or uptade can do this Universe UA
I thought you were joking until I saw the video was two hours long! Good job
Mistakes in Part 1:
Planck Length is come before Graviton should come after Planck Particle
Yoctometer is 1E-24
Zeptometer is 1E-21
Attometer is 1E-18
Femtometer 1E-15
Mistakes in Part 2:
Picometer is 1E-12
Wrong spell on Nickel atom
Mistake in Part 3:
Nanometer is 1E-9
Mistakes in Part 9:
Alpha Centauri B Size is mistake should be: 1 211 280 km
Procyon Size is mistake should be: 2 716 873 km
Mistakes in Part 10:
Outer Solar System Size is mistake should be: 12 132 650 000 km
Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System
Mistakes in Part 11:
RCW 49 unit is mistake should be:
350 LY
NGC 4889 Size is mistake should be: 1 000 000 LY
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
I also noticed this error (in 1 part)
A lighthearted is approximately
9,400,312,654,400 KM
I don't get the first one
Absolutely fascinating❤
you deserve way more views.
Beautifully done!
Why you copied me word for word 😒
Part 1: 0:12
Part 2: 11:21
Part 3: 24:03
Part 4: 33:43
Part 5: 43:27
Part 6: 59:50
Part 7: 1:19:51
Part 8: 1:31:18
Part 9: 1:43:56
Part 10: 2:01:14
Part 11: 2:12:29
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
Part 12 My Version 2:15:27
@@andysshitpostchannel6596 F___ Y__
i like how at the start you put the x button on mobile ads
Mistakes in Everything Size Comparison 2021
Mistakes in Part 1:
Planck Length is come before Graviton should come after Planck Particle
Yoctometer is 1E-24
Zeptometer is 1E-21
Attometer is 1E-18
Femtometer is 1E-15
Mistakes in Part 2:
Picometer is 1E-12
Wrong spell on Nickel atom
Mistake in Part 3:
Nanometer is 1E-9
Mistakes in Part 9:
Alpha Centauri B Size is mistake should be: 1,211,280km
Procyon Size is mistake should be: 2,716,873km
Mistakes in Part 10:
Outer Solar System Size is mistake should be: 12,132,650,000km
Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System
Mistakes in Part 11:
RCW 49 unit is mistake should be: 350 LY
NGC 4889 size is mistake should be: 1,000,000 LY
Im very surprised bro it's amazing! How many hours you do that???
I've been working on the series since January
@@UniverseUA Ur really legend bro
@Mathis R.V
@Red / Blue Monke lol
@@UniverseUA what
I like how you put music from Transformers: Fall of Cybertron.
wow I like the coffe bean deisign
Mistakes in EVERYTHING Size Comparison 2021
Planck Length is come before Graviton should come after Planck Particle
Yoctometer is 1E-24 not 1E-21
Zeptometer is 1E-21 not 1E-18
Attometer is 1E-18 not 1E-15
Femtometer is 1E-15 not 1E-12
Picometer is 1E-12 not 1E-9
Wrong spell on N(i)ckel atom not Nckel atom
Nanometer is 1E-9 not 1E-12
Alpha Centauri B Size is mistake should be: (1,2)11,280 km not 111,280 km
Procyon Size is mistake should be: (2,71)6,873 km not 176,873 km
Outer Solar System Size is mistake should be: 12,132,650(,000) km not 12,132,650 km
Outer Solar System,Kuiper Belt is come before Quasi Star should come after Vega System
RCW 49 unit is mistake should be: 350 LY not 350 LYm
NGC 4889 size is mistake should be: 1,000,00(0) LY not 1,000,00 LY
Here we go, probably the longest size comparison video in TH-cam.
2179 objects
Add 23
im making a size comparison with at least 1k objects
nope forget the 2022 at the end of the year!
@@callielosee3692 Lets think about Universe UA make everything size comparison 2023
Is this the whole thing?? Omg I’m so ready
Yup, this is the whole thing.
The whole thing is upto observable universe, beyond that was just an imagination
@@kimkimashepherd8041 I agree!
@@laiyemoboys9255 hamster? Cat? Rabbit? Shark?
I like Blender and your animation
Verses
2:28:07 - Observable Universe
93 billion light-years
2:28:08 - Universe
150 billion light years
2:28:16 - Imaginary Tetrahedron
1.48 trillion lightyears
2:28:23 Imaginary Dodecahedron
5.27 trillion lightyears
2:28:29 Imaginary Hexahedron
13.48 trillion lightyears
2:28:36 - Imaginary Icosidodecahedron
32.47 trillion lightyears
2:28:43 - Large Universe
148.27 trillion lightyears
2:28:51 - Mandelbrot Zoom
481.36 trillion lightyears
2:28:57 - Large Yoctoverse
824.27 trillion lightyears
2:29:05 - Multiverse
1.3 quadrillion lightyears
2:29:13 - Metaverse
5.28 quadrillion lightyears
2:29:19 - Megaverse
9.17 quadrillion light-yearz
2:29:25 - Gigaverse
62.36 quadrillion lightyears
2:29:33 - Teraverse
158.28 quadrillion lightyears
2:29:39 - Exaverse
964.28 quadrillion lightyears
2:29:47 - I-verse
9.27 quintillion lightyears
2:29:54 - Xenoverse
23.36 quintillion lightyears
2:30:00 - Hyperverse
94.27 quintillion lightyears
2:30:07 - Omniverse
6.28 decillion lightyears
2:30:15 - The Outside
8.26 novemdecillion lightyears
2:30:21 - Barrel
9.47 quattuorvigintillion lightyears
2:30:28 - The box
9.42 sextrigintillion lightyears
2:30:35 - Infinity
1.2 septuagintacentillion lightyears
2:30:43 - Transinfinity
6.2 quattuorsexagintaducentillion lightyears
?:??:?? - Mega-infinity
8.2 trucentillion lightyears
?:??:?? - Megafinity
41.2 quinquagintatrucentillion lightyears
Uhhhhhh
0:16: Pt. 1
0:17: Protoverse
0:34: Planck Length
0:47: Graviton
1:02: Tau Neutrino
1:16: String
1:30: Brane
1:44: Anti-Proton
1:58: Anti-Neutron
2:12: X-Boson
2:26: Muon Neutrino
I’m to lazy to finish, can other people do it for me? Please!
Nope
Yeah
I love the comparisons
Thanks you very much ! The video has more scientific and ultra intelligent from small to large ! 🥳🙂😃🧡🧡🧡💚💚💚
Fascinating and terrifying at the same time. Thank you for this video! Bravo!
No
How i not done
@@buzzybees1239 ?
A BUCKEYBALL; ONE QUADRILLION
DIAMETERS of MEV NEUTRINO/A
SCHHOLYARD GAME MARBLE;
10 Million DIAMETERS of BUCKYBALL/ Approx 100
marbles go across the Expanse
of one METER.
7 Particle
9 Quarks
13 Nulucus
390 Atom
40 Molecule
20 Cell
90 animal humans
89 Astoroid
60 Dwarf planet and moons
100 Planet
300 Star
45 Black Hole and nebula
9 Galaxy
34 Cluster
11 Infinity and Verse
56 Exoplanet
Now that's an enormous video. Good job
That'll be fun to see these stars in the milky the same thing about it doesn't matter how many times can you take the time off boosters when texts about abilities are going here right now but everyone is going here right even though the weather is the weirdest dream about a car quick to eat and get back with another
This video also high graphics 4k Amazing
The fact he wanted to joke around so then he put an x for mobile game adds
A very simple interpretation is when you answer the phone to take an order, corporate restaurants encourage you to answer with a smile. It’s true you hear the person taking your order while smiling. He takes this idea to an utmost extreme and amazing talent.
An
wow bro you deserve like 59 million subs and over billion views
But it's just size
bro what th- HOW ARE YOU SO GOOD
8:02 Weird music
Naw
2:16:29 What Light years For Light yearsm
Thanks for making this video.... Now I can learn about universe....🥰🥰🥰❣️..
But Its just size
Very great and entertaining 3D 4K 60FPS size comparison video!
Also, I’m looking for the title of the soundtrack for a day-2:27:20 . I hope that someone may know what the soundtrack is called. thank you so much!!!
@Ferrel Fadri i see you everywhere
The song is Rise of the Harkoonken
0:18 smallest theory
0:36 smallest length
1:19 biggest theory
8:48 smallest neucles
MORE TO COME!
YES
@@callielosee3692 YESSSS!
Great job.
What sounds did you use for the tank’s
The sounds are from the games World of Tanks and World of Tanks Blitz. I combined and/or stretched some
Oh yes!!! Amazing and fascinating!!!
@Ferrel Fadri ok
But i can do how
@@buzzybees1239 what
Great design 👍
where did you get the noises for the quasi star and the black holes?
Here are the sounds that I used
freesound.org/people/Kinoton/sounds/369516/
freesound.org/people/TimoSchmied/sounds/530974/
freesound.org/people/ejfortin/sounds/49692/
freesound.org/people/ejfortin/sounds/49679/
freesound.org/people/RICHERlandTV/sounds/216089/
@@UniverseUA thanks :D
Part 1: 0:00-11:06
Part 2-11:06-24:00
Part 3- 24:00-33:44
Part 4 33:44-43:08
Part 5 43:08-59:52
Part 6 59:52-1:19:51
Part 7 1:19:51-1:31:18
Part 8 1:31:18-1:43:55
Part 9 1:43:55- 2:01:21
Part 10 2:01:21 - 2:12:17
Part 11 2:12:17 - 2:31:13
Created by presents...
Universe Size Comparison!!!
Make sure like and subcribe!
Ready? Go!
Start Pronational 0:01
Beginning 0:34
Expanding more massless 1:31
Even Really really Small 2:31
New things that changed: Unonoctium: The new name for unonoctium is Oganesson.
No, don’t listen to him. It’s called unonoctium!😡🤬😾😿
You deserve more more more more more more more more more more more more more more more more more more more more more more more more more more more more more 1 million times more comments and likes subscribers and stuff!!!!
I recently started noticing audio glitches (notably some of the music is cut out) in this vid and I don't know if it's just me.
Yep, had to remove some music due to copyright
Yea,there.were green stuff popping around the screen at around the first hour
uhh, im sorry, but, what is the first picture that you showed. i really don't understand?
X button on mobile ads.
X button on mobile game ads.
IT IS 2 HOURS
BE PASSENT
your size comparison is less than 2 hours
Geometry Dash icon
make it x2 speeed to make it 1 hour🤓👆🏻
Omg
I just like planet and all of universe
Planets are in the universe
A lightyear is something like
8,985,456,300,000 KILOMETERS.
Imanige how much kilometers is in 93 billion light years
@@Meandpigeoncoolio how about 3760
Color of VV Cephei A at 2:06:10 is wrong. This is a reference to older size comparisons, dating from 2006 - 2010
VV Cephei A is red
I subscribed.😇
Thanks :)
Me too
Infiniy < Absolute infinity
I love science
This is everthing in My brain 🧠
amazing, really. good job man, this is incredible!!!
12,742,000,000,000 LYSOSOMES
lined up back to back/Single File
would be needed to span across the
Diameter of PLANET EARTH.
This cuwld be in Netflix.11/11
To understand how small the Planck length is, I will say the following: a person is as much longer than the Planck length as a person is larger than an object that is about 100 million times larger than the observable universe. And that for the Planck length, in human equivalent, the observable universe is an object that is about 3 times the width of human DNA. And I will also say that in the middle between the dimensions of the Planck length and the observable universe there is a grain of sand about 0.1 millimeters in size.
Enjoyed!
This ... is like a movie
Right.
Okay, but the bug that starts in part 8 where green flashing lights start to pop up hasn't been fixed.
Unfortunately, I couldn't fix it because re-rendering that would've taken eternity
@@UniverseUA Where is Horsehead nebula and the other smaller galaxies and I think Orion Nebula is In thes but I promise I’m not trying to be a critic
@@UniverseUA it's really bad and distracting
@Universe UA that was a sad comment
Its's at 1:31:21
hello i love the comparison TYSM to help me to that now i created a book in that :) i sub now and like
I was just thinking, we are part of the universe... What if our conscious selves are nothing more than a particle of matter? That would kinda put a damper on every religion... We know nothing...
2:10:36
This black hole Messier 60 is the most voices from MONSTER
EVERYTHING Size Comparison 2021 (FULL) 3D 4K 60FPS
ENJOY
Bro I love this Music
I love this vid 2000000Ly+ Of Size Of coolness!!!!!!!!!!!!!!!!!!!!!!!!!!!
01:08:16
Smol❌ Small☑️
👍🏻
I like ur size comparision
"The x button in mobile game ads"
4 millimeters
2:28:50 mandelbrot like drip zoom🤣
Good times…
Isso afeta até o Grêmio 👏👏👏
Great job too
Good 👍 job ok
stunned
Protoverse
Plank length
Graviton
Tau nurtino
String
Brane
Anti proton
Anti neutron
X boson
Muon nurtino
Y boson
Electron nurtino
Fermion
Tacyon
Calabi yau manfod
Quantum foam
Muon
Plank particle
Yotcometer
1 meV neutrino
Don’t forget the cat’s eye nebula!😅
1:20:53 No, Earth is alien's prison! 🌚 The moon alien's are proof of ours!
👍👍
Wow awesome you thought us everything
Isn't it cruel to think that almost everything very small in the video is around you and in you, right now?
Top 5 smallest things: 5th Smallest: Tau neutrino 4th Smallest: Graviton 3rd Smallest: Plank length 2nd Smallest: Protoverse The smallest: X button on mobile game ads.
Yes
SO TRUUUUEEE
@Thetommymasterthe joke flew 5,000 miles away from your head
@jeanpierfinalcupalarcon2023 bro the joke is a meme
@jeanpierfinalcupalarcon2023 it’s sarcasm
At 01:45:00 you didn't fix Alpha Centuari B's diameter.
Not 112.280 km its 1.112.280 km
Ultra underrated
So cool!
Good except for the 20 minute atoms section, that was boring.
I like
Wow
You forgot the biggest thing of all
Are you talking about where it is white all over the place?
Is it casoeh
@@RainbowBeanPlayz-mo3bw what is that?
you are so underrated, you should have at least 100k subs, not 13k